Property Summary

NCBI Gene PubMed Count 22
Grant Count 53
R01 Count 14
Funding $32,654,907.49
PubMed Score 41.52
PubTator Score 27.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma 1.800 0.000
non-small cell lung cancer 1.890 0.000
interstitial cystitis -3.900 0.000
psoriasis 1.700 0.000
nasopharyngeal carcinoma -1.100 0.000
spina bifida -1.487 0.037

Pathway (1)

Gene RIF (13)

PMID Text
27018475 We identified both rare dominant mutations and a common risk variant in the coding region of GRHL3 as causative in individuals with nonsyndromic cleft palate only.
27018472 We discovered a genome-wide significant association with a missense variant in GRHL3 and replicated the result in an independent sample of case and control subjects. In both samples, rs41268753 conferred increased risk for cleft palate.
26069269 GRHL1, GRHL2, and GRHL3 have roles in cellular proliferation, differentiation, adhesion, and polarity and may promote cancer or be tumor suppressors [review]
26063791 We defined a novel molecular signature in mammalian HNSCC, suggesting new treatment strategies targeting the GRHL3/GSK3B/c-MYC proto-oncogenic network.
24363083 our results indicate predominant GRHL3 expression in breast cancers
24360809 Our data demonstrated that mutations in two genes, IRF6 and GRHL3, can lead to nearly identical phenotypes of orofacial cleft.
23685552 The splice variant-derived isoforms SOM1 and SOM3 induce opposing effects in primary human endothelial cells and in a whole animal model, most likely through the induction of different target genes.
22931925 In human keratinocytes, IRF6 bound conserved elements near the GRHL3 promoter, with one of these elements having enhancer activity.
22829784 we define a previously unknown role for the transcription factor GRHL3 in the recruitment of a trxG complex to promoters of genes, leading to increased H3K4 methylation and gene expression
22614019 decreased Grhl3 expression contributes to tumor progression and upregulation of the oncomir miR-21 in squamous cell carcinoma of the skin.
More...

AA Sequence

MSNELDFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPLTAATKAMMRVNGDDDSVAALSFLYDYYMGP      1 - 70
KEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALP     71 - 140
TPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPD    141 - 210
ILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVK    211 - 280
SVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSFVWNVNEEAKV    281 - 350
FIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKV    351 - 420
KCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKR    421 - 490
TCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYK    491 - 560
KCKRGETSLLHPRLSRHPPPDCLECSHPVTQVRNMGFGDGFWRQRDLDSNPSPTTVNSLHFTVNSE        561 - 626
//

Text Mined References (23)

PMID Year Title
27018475 2016 Sequencing the GRHL3 Coding Region Reveals Rare Truncating Mutations and a Common Susceptibility Variant for Nonsyndromic Cleft Palate.
27018472 2016 A Genome-wide Association Study of Nonsyndromic Cleft Palate Identifies an Etiologic Missense Variant in GRHL3.
26069269 2015 Recent discoveries concerning the involvement of transcription factors from the Grainyhead-like family in cancer.
26063791 2015 Identification of a Novel Proto-oncogenic Network in Head and Neck Squamous Cell Carcinoma.
25347468 2014 A GRHL3-regulated repair pathway suppresses immune-mediated epidermal hyperplasia.
24363083 2014 Clinical implications of GRHL3 protein expression in breast cancer.
24360809 2014 Dominant mutations in GRHL3 cause Van der Woude Syndrome and disrupt oral periderm development.
23685552 2013 Two isoforms of Sister-Of-Mammalian Grainyhead have opposing functions in endothelial cells and in vivo.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22931925 2013 Interferon regulatory factor 6 promotes differentiation of the periderm by activating expression of Grainyhead-like 3.
More...