Property Summary

NCBI Gene PubMed Count 29
PubMed Score 51.01
PubTator Score 27.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
spina bifida -1.487 3.7e-02
ependymoma 1.200 4.2e-04
interstitial cystitis -2.300 1.4e-02
nasopharyngeal carcinoma -1.100 1.4e-04
non-small cell lung cancer 1.890 9.8e-09
psoriasis 1.600 4.0e-40

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (20)

AA Sequence

MSNELDFRSVRLLKNDPVNLQKFSYTSEDEAWKTYLENPLTAATKAMMRVNGDDDSVAALSFLYDYYMGP      1 - 70
KEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSLEGALP     71 - 140
TPGKAAPLPAGPSKLEAGSVDSYLLPTTDMYDNGSLNSLFESIHGVPPTQRWQPDSTFKDDPQESMLFPD    141 - 210
ILKTSPEPPCPEDYPSLKSDFEYTLGSPKAIHIKSGESPMAYLNKGQFYPVTLRTPAGGKGLALSSNKVK    211 - 280
SVVMVVFDNEKVPVEQLRFWKHWHSRQPTAKQRVIDVADCKENFNTVEHIEEVAYNALSFVWNVNEEAKV    281 - 350
FIGVNCLSTDFSSQKGVKGVPLNLQIDTYDCGLGTERLVHRAVCQIKIFCDKGAERKMRDDERKQFRRKV    351 - 420
KCPDSSNSGVKGCLLSGFRGNETTYLRPETDLETPPVLFIPNVHFSSLQRSGGAAPSAGPSSSNRLPLKR    421 - 490
TCSPFTEEFEPLPSKQAKEGDLQRVLLYVRRETEEVFDALMLKTPDLKGLRNAISEKYGFPEENIYKVYK    491 - 560
KCKRGETSLLHPRLSRHPPPDCLECSHPVTQVRNMGFGDGFWRQRDLDSNPSPTTVNSLHFTVNSE        561 - 626
//

Text Mined References (30)

PMID Year Title