Property Summary

NCBI Gene PubMed Count 13
PubMed Score 2.67
PubTator Score 3.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 4.09003869587097E-8
ependymoma 2514 4.17780285209083E-8
atypical teratoid / rhabdoid tumor 4369 4.64868663381474E-7
ulcerative colitis 2087 1.61901423053597E-5
acute quadriplegic myopathy 1157 3.00782030396661E-5
pilocytic astrocytoma 3086 6.70901458576799E-5
pediatric high grade glioma 2712 2.28930287233958E-4
sonic hedgehog group medulloblastoma 1482 3.35171925700653E-4
glioblastoma 5572 0.00113582989418489
psoriasis 6685 0.00157052783913353
active Crohn's disease 918 0.00325735035112664
diabetes mellitus 1663 0.0101501076467713
colon cancer 1475 0.0154091445325283
aldosterone-producing adenoma 664 0.0336240612729007
Disease Target Count Z-score Confidence
Pancreatitis 97 3.577 1.8

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis -1.200 0.002
glioblastoma 1.500 0.001
ependymoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
acute quadriplegic myopathy 1.092 0.000
colon cancer 1.400 0.015
active Crohn's disease 1.208 0.003
diabetes mellitus -1.300 0.010
pediatric high grade glioma 1.400 0.000
sonic hedgehog group medulloblastoma 1.500 0.000
pilocytic astrocytoma 1.200 0.000
aldosterone-producing adenoma -1.047 0.034
ulcerative colitis 1.200 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q8TE76 A1YR23 A1YR24 H7BXF1 Q5JUK7 Q96MZ2 Q9HAI7
Symbols ZCW4
ZCWCC2
dJ75H8.2

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
26827181 Genetic variation in MORC4, CD14, and TLR4 may affect the outcome of allogeneic stem cell transplantation.
26820620 Genetic variants in CLDN2 and MORC4 genes were associated with chronic pancreatitis in Indian patients.
25253127 Single nucleotide polymorphism is a risk factor developing chronic alcoholic pancreatitis.
23946598 Findings suggest that a variant of the CLDN2-MORC4 region predisposes to Crohn's disease in a Swedish population.

AA Sequence

MLLYRGAPAGPGAPGCGLARPGGGPQAFGIRLSTMSPRYLQSNSSSHTRPFSAIAELLDNAVDPDVSART      1 - 70
VFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGVFGNGFKSGSMRLGKDALVFT     71 - 140
KNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNKKMIITEDSLPSLEAILNYSIFNRENDLLAQFDAI    141 - 210
PGKKGTRVLIWNIRRNKNGKSELDFDTDQYDILVSDFDTEEKMTGGVTSELPETEYSLRAFCGILYMKPR    211 - 280
MKIFLRQKKVTTQMIAKSLANVEYDTYKPTFTNKQVRITFGFSCKNSNQFGIMMYHNNRLIKSFEKVGCQ    281 - 350
VKPTRGEGVGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALAQKLNAYWKEKTSQDNFETSTVARPIPK    351 - 420
VPDQTWVQCDECLKWRKLPGKIDPSMLPARWFCYYNSHPKYRRCSVPEEQELTDEDLCLSKAKKQEQTVE    421 - 490
EKKKMPMENENHQVFSNPPKILTVQEMAGLNNKTIGYEGIHSPSVLPSGGEESRSPSLQLKPLDSSVLQF    491 - 560
SSKYKWILGEEPVEKRRRLQNEMTTPSLDYSMPAPYRRVEAPVAYPEGENSHDKSSSERSTPPYLFPEYP    561 - 630
EASKNTGQNREVSILYPGAKDQRQGSLLPEELEDQMPRLVAEESNRGSTTINKEEVNKGPFVAVVGVAKG    631 - 700
VRDSGAPIQLIPFNREELAERRKAVESWNPVPYSVASAAIPAAAIGEKARGYEESEGHNTPKLKNQRELE    701 - 770
ELKRTTEKLERVLAERNLFQQKVEELEQERNHWQSEFKKVQHELVIYSTQEAEGLYWSKKHMGYRQAEFQ    771 - 840
ILKAELERTKEEKQELKEKLKETETHLEMLQKAQVSYRTPEGDDLERALAKLTRLRIHVSYLLTSVLPHL    841 - 910
ELREIGYDSEQVDGILYTVLEANHILD                                               911 - 937
//

Text Mined References (13)

PMID Year Title
26827181 2016 Single Nucleotide Polymorphisms in MORC4, CD14, and TLR4 Are Related to Outcome of Allogeneic Stem Cell Transplantation.
26820620 2016 Common Variants in CLDN2 and MORC4 Genes Confer Disease Susceptibility in Patients with Chronic Pancreatitis.
25253127 2015 Polymorphisms at PRSS1-PRSS2 and CLDN2-MORC4 loci associate with alcoholic and non-alcoholic chronic pancreatitis in a European replication study.
23946598 2013 Analysis of single nucleotide polymorphisms in the region of CLDN2-MORC4 in relation to inflammatory bowel disease.
23143602 2012 Common genetic variants in the CLDN2 and PRSS1-PRSS2 loci alter risk for alcohol-related and sporadic pancreatitis.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
17608765 2007 MORC4, a novel member of the MORC family, is highly expressed in a subset of diffuse large B-cell lymphomas.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15772651 2005 The DNA sequence of the human X chromosome.
More...