Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.63
PubTator Score 3.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
nasopharyngeal carcinoma 1056 2.04071236146367E-7
pancreatic cancer 2300 3.73305838258141E-6
malignant mesothelioma 3163 6.81873134264118E-5
ovarian cancer 8492 1.35115723556152E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 2.23749345026594E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.95716806147401E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00377060425955882
primary Sjogren syndrome 789 0.00496343835629467
breast carcinoma 1614 0.0160394143508864
invasive ductal carcinoma 2950 0.0177673858026116
colon cancer 1475 0.0197406103493728
pancreatic ductal adenocarcinoma liver metastasis 1795 0.020737074332038
fibroadenoma 557 0.0347080243898068
spina bifida 1064 0.0445085648081828
lung cancer 4473 0.0496014441665682

Expression

Synonym

Accession Q8TE68 Q71RE2 Q8NC10 Q96BB7 Q9BSQ2 Q9GZQ2 Q9NXH0 EPS8-like protein 1
Symbols DRC3
EPS8R1
PP10566

Gene

PDB

2ROL   2K2M  

  Ortholog (7)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid

AA Sequence

MSTATGPEAAPKPSAKSIYEQRKRYSTVVMADVSQYPVNHLVTFCLGEDDGVHTVEDASRKLAVMDSQGR      1 - 70
VWAQEMLLRVSPDHVTLLDPASKEELESYPLGAIVRCDAVMPPGRSRSLLLLVCQEPERAQPDVHFFQGL     71 - 140
RLGAELIREDIQGALHNYRSGRGERRAAALRATQEELQRDRSPAAETPPLQRRPSVRAVISTVERGAGRG    141 - 210
RPQAKPIPEAEEAQRPEPVGTSSNADSASPDLGPRGPDLAVLQAEREVDILNHVFDDVESFVSRLQKSAE    211 - 280
AARVLEHRERGRRSRRRAAGEGLLTLRAKPPSEAEYTDVLQKIKYAFSLLARLRGNIADPSSPELLHFLF    281 - 350
GPLQMIVNTSGGPEFASSVRRPHLTSDAVALLRDNVTPRENELWTSLGDSWTRPGLELSPEEGPPYRPEF    351 - 420
FSGWEPPVTDPQSRAWEDPVEKQLQHERRRRQQSAPQVAVNGHRDLEPESEPQLESETAGKWVLCNYDFQ    421 - 490
ARNSSELSVKQRDVLEVLDDSRKWWKVRDPAGQEGYVPYNILTPYPGPRLHHSQSPARSLNSTPPPPPAP    491 - 560
APAPPPALARPRWDRPRWDSCDSLNGLDPSEKEKFSQMLIVNEELQARLAQGRSGPSRAVPGPRAPEPQL    561 - 630
SPGSDASEVRAWLQAKGFSSGTVDALGVLTGAQLFSLQKEELRAVSPEEGARVYSQVTVQRSLLEDKEKV    631 - 700
SELEAVMEKQKKKVEGEVEMEVI                                                   701 - 723
//

Text Mined References (18)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644376 2008 Structural basis of PxxDY motif recognition in SH3 binding.
17617578 2007 Reciprocal regulation of SH3 and SH2 domain binding via tyrosine phosphorylation of a common site in CD3epsilon.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14565974 2004 The eps8 family of proteins links growth factor stimulation to actin reorganization generating functional redundancy in the Ras/Rac pathway.
12620401 2003 In silico analysis of the EPS8 gene family: genomic organization, expression profile, and protein structure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10514543 1999 [Cloning and expression analyses of down-regulated cDNA C6-2A in human esophageal cancer].