Property Summary

NCBI Gene PubMed Count 18
PubMed Score 5.23
PubTator Score 6.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver neoplasms 130 0.0 0.0
Weill-Marchesani-Like Syndrome 2 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 3.1e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0
osteosarcoma 7950 0.0 4.56285083963743E-4
Disease Target Count Z-score Confidence
Weill-Marchesani syndrome 14 6.129 3.1
Tracheal stenosis 23 3.33 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.706 4.6e-04
ovarian cancer -1.500 3.1e-08

Gene RIF (11)

AA Sequence

MCDGALLPPLVLPVLLLLVWGLDPGTAVGDAAADVEVVLPWRVRPDDVHLPPLPAAPGPRRRRRPRTPPA      1 - 70
APRARPGERALLLHLPAFGRDLYLQLRRDLRFLSRGFEVEEAGAARRRGRPAELCFYSGRVLGHPGSLVS     71 - 140
LSACGAAGGLVGLIQLGQEQVLIQPLNNSQGPFSGREHLIRRKWSLTPSPSAEAQRPEQLCKVLTEKKKP    141 - 210
TWGRPSRDWRERRNAIRLTSEHTVETLVVADADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGIKINIQ    211 - 280
VTKLVLLRQRPAKLSIGHHGERSLESFCHWQNEEYGGARYLGNNQVPGGKDDPPLVDAAVFVTRTDFCVH    281 - 350
KDEPCDTVGIAYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHNLGMNHDDDHSSCAGRSHIMSGEWVKG    351 - 420
RNPSDLSWSSCSRDDLENFLKSKVSTCLLVTDPRSQHTVRLPHKLPGMHYSANEQCQILFGMNATFCRNM    421 - 490
EHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWSPWGAWSMCSRTCG    491 - 560
TGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDD    561 - 630
KPCELYCSPLGKESPLLVADRVLDGTPCGPYETDLCVHGKCQKIGCDGIIGSAAKEDRCGVCSGDGKTCH    631 - 700
LVKGDFSHARGTALKDSGKGSINSDWKIELPGEFQIAGTTVRYVRRGLWEKISAKGPTKLPLHLMVLLFH    701 - 770
DQDYGIHYEYTVPVNRTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND    771 - 840
SDCPQASRPEPQVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRP    841 - 910
AAVQSCEGQDCLSIWEASEWSQCSASCGKGVWKRTVACTNSQGKCDASTRPRAEEACEDYSGCYEWKTGD    911 - 980
WSTCSSTCGKGLQSRVVQCMHKVTGRHGSECPALSKPAPYRQCYQEVCNDRINANTITSPRLAALTYKCT    981 - 1050
RDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYANKMRQPPPNS                            1051 - 1095
//

Text Mined References (19)

PMID Year Title