Property Summary

NCBI Gene PubMed Count 14
Grant Count 14
Funding $2,675,918.25
PubMed Score 18.88
PubTator Score 9.97

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
16524946 The trafficking to the cell surface suggests novel functional upregulation of SLC26A7 in states that are associated with hypokalemia or increased medullary tonicity.
15956810 In human kidney SLC26A6 and A7 have a distinct, partially overlapping expression in distal segments of nephrons. The distribution partly differs from that found previously in rodent kidneys.
11829495 the molecular cloning from human HEVEC of a 2.9-kb cDNA encoding SLC26A7, a novel member of the SLC26 (solute carrier 26) sulfate/anion exchanger family

AA Sequence

MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQQVTQGLAFAV      1 - 70
LSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVPQNMQNLTTQSNTSVLGLSDF     71 - 140
EMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVISAMTTGAATHVVTSQVKYLLGMKMPYISGPL    141 - 210
GFFYIYAYVFENIKSVRLEALLLSLLSIVVLVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMEN    211 - 280
TYGLEVVGHIPQGIPSPRAPPMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLS    281 - 350
NIVSSFFFCIPSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM    351 - 420
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSIKNMKEMEFKV    421 - 490
KTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEE    491 - 560
ASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDSEKPIF    561 - 630
FESVSAAISHIHSNKNLSKLSDHSEV                                                631 - 656
//

Text Mined References (16)

PMID Year Title
24647542 2014 N-glycosylation and topology of the human SLC26 family of anion transport membrane proteins.
21897333 2011 Genes linked to energy metabolism and immunoregulatory mechanisms are associated with subcutaneous adipose tissue distribution in HIV-infected men.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
17504921 2007 Expression of ion transport-associated proteins in human efferent and epididymal ducts.
16524946 2006 Chloride/bicarbonate exchanger SLC26A7 is localized in endosomes in medullary collecting duct cells and is targeted to the basolateral membrane in hypertonicity and potassium depletion.
15956810 2005 SLC26A6 and SLC26A7 anion exchangers have a distinct distribution in human kidney.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284286 2004 Differential regulation of basolateral Cl-/HCO3- exchangers SLC26A7 and AE1 in kidney outer medullary collecting duct.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12965893 2004 SLC26A7: a basolateral Cl-/HCO3- exchanger specific to intercalated cells of the outer medullary collecting duct.
More...