Property Summary

NCBI Gene PubMed Count 14
PubMed Score 19.42
PubTator Score 9.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.400 5.0e-02
ependymoma 1.900 1.6e-03
gastric carcinoma -2.800 1.2e-02
group 3 medulloblastoma 2.100 2.7e-05
intraductal papillary-mucinous adenoma (... 2.000 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 3.8e-02
ovarian cancer 2.900 2.1e-03
psoriasis -1.100 2.1e-09

Gene RIF (3)

AA Sequence

MTGAKRKKKSMLWSKMHTPQCEDIIQWCRRRLPILDWAPHYNLKENLLPDTVSGIMLAVQQVTQGLAFAV      1 - 70
LSSVHPVFGLYGSLFPAIIYAIFGMGHHVATGTFALTSLISANAVERIVPQNMQNLTTQSNTSVLGLSDF     71 - 140
EMQRIHVAAAVSFLGGVIQVAMFVLQLGSATFVVTEPVISAMTTGAATHVVTSQVKYLLGMKMPYISGPL    141 - 210
GFFYIYAYVFENIKSVRLEALLLSLLSIVVLVLVKELNEQFKRKIKVVLPVDLVLIIAASFACYCTNMEN    211 - 280
TYGLEVVGHIPQGIPSPRAPPMNILSAVITEAFGVALVGYVASLALAQGSAKKFKYSIDDNQEFLAHGLS    281 - 350
NIVSSFFFCIPSAAAMGRTAGLYSTGAKTQVACLISCIFVLIVIYAIGPLLYWLPMCVLASIIVVGLKGM    351 - 420
LIQFRDLKKYWNVDKIDWGIWVSTYVFTICFAANVGLLFGVVCTIAIVIGRFPRAMTVSIKNMKEMEFKV    421 - 490
KTEMDSETLQQVKIISINNPLVFLNAKKFYTDLMNMIQKENACNQPLDDISKCEQNTLLNSLSNGNCNEE    491 - 560
ASQSCPNEKCYLILDCSGFTFFDYSGVSMLVEVYMDCKGRSVDVLLAHCTASLIKAMTYYGNLDSEKPIF    561 - 630
FESVSAAISHIHSNKNLSKLSDHSEV                                                631 - 656
//

Text Mined References (16)

PMID Year Title