Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.76
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.700 0.000
ependymoma -3.100 0.000
glioblastoma -3.600 0.000
oligodendroglioma -1.700 0.000
osteosarcoma -1.495 0.000
medulloblastoma -2.600 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -2.500 0.000
active ulcerative colitis -1.138 0.022
pediatric high grade glioma -3.300 0.000
pilocytic astrocytoma -2.700 0.000
subependymal giant cell astrocytoma -2.565 0.019
ovarian cancer -1.700 0.000

Synonym

Accession Q8TE49 Q8IWK5
Symbols OTUD7
C15orf16
C16ORF15
CEZANNE2

Gene

PDB

2L2D  

Gene RIF (2)

PMID Text
23792447 Snail1-mediated suppression of Cezanne2 may have a key role in HCC malignancy.
20400778 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVH      1 - 70
TANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNE     71 - 140
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNC    141 - 210
LLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRT    211 - 280
HFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVP    281 - 350
PNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARL    351 - 420
AHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNG    421 - 490
KNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERG    491 - 560
KEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQ    561 - 630
GERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPET    631 - 700
EGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQS    701 - 770
VIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGT    771 - 840
AGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGRAETEHYCSYC    841 - 910
YREELRRRREARGARP                                                          911 - 926
//

Text Mined References (9)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23827681 2013 OTU deubiquitinases reveal mechanisms of linkage specificity and enable ubiquitin chain restriction analysis.
23792447 2014 Snail1-dependent transcriptional repression of Cezanne2 in hepatocellular carcinoma.
23650146 2013 A genome-wide association study for venous thromboembolism: the extended cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
20622874 2010 Lys11-linked ubiquitin chains adopt compact conformations and are preferentially hydrolyzed by the deubiquitinase Cezanne.
20400778 2010 Genomic variation associated with mortality among adults of European and African ancestry with heart failure: the cohorts for heart and aging research in genomic epidemiology consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.