Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.76
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active ulcerative colitis -1.138 2.2e-02
adult high grade glioma -1.400 3.7e-05
astrocytic glioma -1.600 9.2e-03
Astrocytoma, Pilocytic -1.300 1.1e-07
atypical teratoid / rhabdoid tumor -1.400 7.1e-06
ependymoma -2.000 1.2e-02
glioblastoma -1.300 4.7e-07
group 3 medulloblastoma -2.600 2.8e-05
medulloblastoma, large-cell -3.500 1.9e-07
oligodendroglioma -1.700 1.5e-11
osteosarcoma -1.495 2.5e-06
ovarian cancer -1.700 2.4e-09
primitive neuroectodermal tumor -2.500 8.2e-06
subependymal giant cell astrocytoma -1.648 8.2e-03

Gene RIF (2)

AA Sequence

MVSSVLPNPTSAECWAALLHDPMTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLTAALSDYEQLRQVH      1 - 70
TANLPHVFNEGRGPKQPEREPQPGHKVERPCLQRQDDIAQEKRLSRGISHASSAIVSLARSHVASECNNE     71 - 140
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTSCKRLLPLATTGDGNC    141 - 210
LLHAASLGMWGFHDRDLVLRKALYTMMRTGAEREALKRRWRWQQTQQNKEEEWEREWTELLKLASSEPRT    211 - 280
HFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRDSGGEAFAPIPFGGIYLPLEVP    281 - 350
PNRCHCSPLVLAYDQAHFSALVSMEQRDQQREQAVIPLTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARL    351 - 420
AHLILSLEAKLNLLHSYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLADSLDSDRDSVCSNSNSNNG    421 - 490
KNGKDKEKEKQRKEKDKTRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMGRANSANGKNGDSAERG    491 - 560
KEKKAKSRKGSKEESGASASTSPSEKTTPSPTDKAAGASPAEKGGGPRGDAWKYSTDVKLSLNILRAAMQ    561 - 630
GERKFIFAGLLLTSHRHQFHEEMIGYYLTSAQERFSAEQEQRRRDAATAAAAAAAAAAATAKRPPRRPET    631 - 700
EGVPVPERASPGPPTQLVLKLKERPSPGPAAGRAARAAAGGTASPGGGARRASASGPVPGRSPPAPARQS    701 - 770
VIHVQASGARDEACAPAVGALRPCATYPQQNRSLSSQSYSPARAAALRTVNTVESLARAVPGALPGAAGT    771 - 840
AGAAEHKSQTYTNGFGALRDGLEFADADAPTARSNGECGRGGPGPVQRRCQRENCAFYGRAETEHYCSYC    841 - 910
YREELRRRREARGARP                                                          911 - 926
//

Text Mined References (9)

PMID Year Title