Property Summary

NCBI Gene PubMed Count 29
Grant Count 74
R01 Count 54
Funding $8,161,806.55
PubMed Score 92.64
PubTator Score 60.72

Knowledge Summary

Patent (48,942)

Synonym

Accession Q8TE23 Q5TZ19
Symbols TR2
T1R2
GPR71

Gene

Gene RIF (21)

PMID Text
26907331 In conclusion, the Val/Val genotype of TAS1R2 was associated with a higher carbohydrate intake and HTG.
26279452 The rs12033832 single nucleotide polymorphism in TAS1R2 is associated with sucrose taste and sugar intake, but the effect differs depending on BMI
25924601 high-risk caries experience (>8 caries) was found to be associated with TAS1R2 rs35874116 homozygous polymorphic genotype.
25029362 human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3
24068707 effects of artificial sweeteners on adipose tissue may be largely independent of the classical sweet taste receptors, T1R2 and T1R3
23349025 Interaction between brazzein and the amino terminal domain of the sweet receptor subunit T1R2 showed a stronger interaction at 7 degrees C than at 37 degrees C.; the low temperature conformation, alters the orientations of 2 loops known to be critical for the sweetness of brazzein, may represent the bound state of brazzei in the complex with the human sweet receptor.
23257979 associated with caries risk
22315413 Genetic ablation of the sweet TR protein T1R2 obliterates fructose-induced insulin release and its potentiating effects on glucose-stimulated insulin secretion in vitro and in vivo.
21540445 T1R2/T1R3 is involved in glucose-dependent secretion of satiation peptides
20943793 Our findings show that a genetic variation in TAS1R2 affects habitual consumption of sugars and may contribute to interindividual differences in changing behaviors in response to dietary counseling.
More...

AA Sequence

MGPRAKTISSLFFLLWVLAEPAENSDFYLPGDYLLGGLFSLHANMKGIVHLNFLQVPMCKEYEVKVIGYN      1 - 70
LMQAMRFAVEEINNDSSLLPGVLLGYEIVDVCYISNNVQPVLYFLAHEDNLLPIQEDYSNYISRVVAVIG     71 - 140
PDNSESVMTVANFLSLFLLPQITYSAISDELRDKVRFPALLRTTPSADHHIEAMVQLMLHFRWNWIIVLV    141 - 210
SSDTYGRDNGQLLGERVARRDICIAFQETLPTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLT    211 - 280
LYHFFNEVLRQNFTGAVWIASESWAIDPVLHNLTELRHLGTFLGITIQSVPIPGFSEFREWGPQAGPPPL    281 - 350
SRTSQSYTCNQECDNCLNATLSFNTILRLSGERVVYSVYSAVYAVAHALHSLLGCDKSTCTKRVVYPWQL    351 - 420
LEEIWKVNFTLLDHQIFFDPQGDVALHLEIVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTI    421 - 490
PMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETSCFKRQLVFLE    491 - 560
WHEAPTIAVALLAALGFLSTLAILVIFWRHFQTPIVRSAGGPMCFLMLTLLLVAYMVVPVYVGPPKVSTC    561 - 630
LCRQALFPLCFTICISCIAVRSFQIVCAFKMASRFPRAYSYWVRYQGPYVSMAFITVLKMVIVVIGMLAT    631 - 700
GLSPTTRTDPDDPKITIVSCNPNYRNSLLFNTSLDLLLSVVGFSFAYMGKELPTNYNEAKFITLSMTFYF    701 - 770
TSSVSLCTFMSAYSGVLVTIVDLLVTVLNLLAISLGYFGPKCYMILFYPERNTPAYFNSMIQGYTMRRD     771 - 839
//

Text Mined References (29)

PMID Year Title
26907331 2016 Sweet Taste Receptor TAS1R2 Polymorphism (Val191Val) Is Associated with a Higher Carbohydrate Intake and Hypertriglyceridemia among the Population of West Mexico.
26279452 2015 Variation in the TAS1R2 Gene, Sweet Taste Perception and Intake of Sugars.
25924601 2015 Association of sweet taste receptor gene polymorphisms with dental caries experience in school children.
25029362 2014 Distinct human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3.
24068707 2013 Artificial sweeteners stimulate adipogenesis and suppress lipolysis independently of sweet taste receptors.
23568457 2013 Genetic variants associated with disordered eating.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23349025 2013 Temperature-dependent conformational change affecting Tyr11 and sweetness loops of brazzein.
23257979 2013 Association of GLUT2 and TAS1R2 genotypes with risk for dental caries.
22888021 2012 G protein-coupled receptors participate in cytokinesis.
More...