Property Summary

NCBI Gene PubMed Count 34
Grant Count 28
R01 Count 20
Funding $4,802,693.86
PubMed Score 63.45
PubTator Score 40.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 0.022
group 4 medulloblastoma 3.700 0.000
psoriasis -1.100 0.000

Gene RIF (22)

PMID Text
26534905 Polymorphisms of dopamine pathway gene aLMX1A is associated with cognitive performance in Bipolar disorder.
26526610 Lmx1a and Lmx1b expression persists in mature dopaminergic neurons of the substantia nigra pars compacta and the ventral tegmental area. [Review]
25380985 To our best knowledge, this is the first report demonstrating the application of TAT-LMX1A recombinant protein to enhance hESC differentiation to DA as shown by the expression of DA specific makers.
25099324 SNPs of the LMX1A gene might be associated with the susceptibility to congenital scoliosis and different clinical phenotypes in the Chinese Han population.
24407576 LMX1A is weakly methylated in cervical adenocarcinomas compared with controls, in a metastatic stage of cervical cancer.
24018208 these data imply that Sp1 and EZH2 may activate LMX1A expression upon oncogenic stress during cervical cancer development.
23165334 higher expression is associated with more advanced neoplasm staging in Chinese patients with pancreatic ductal adenocarcinomas
22882568 Higher immunostaining intensity for OPN and LMX1A correlated with WHO grades for meningiomas and some gliomas. Contrary to our expectations, LMX1A staining in WHO grade IV gliomas was shown to be weaker than in WHO grade III tumours.
21624811 The Lmx1a can induce desired neuronal lineages from most expressing neural progenitor cells by a mechanism resembling developmental binary cell-fate switching.
21435346 One single nucleotide polymorphisms of lmx1a was strongly associated with the magnitude of training-related gains in verbal working memory
More...

AA Sequence

MLDGLKMEENFQSAIDTSASFSSLLGRAVSPKSVCEGCQRVILDRFLLRLNDSFWHEQCVQCASCKEPLE      1 - 70
TTCFYRDKKLYCKYDYEKLFAVKCGGCFEAIAPNEFVMRAQKSVYHLSCFCCCVCERQLQKGDEFVLKEG     71 - 140
QLLCKGDYEKERELLSLVSPAASDSGKSDDEESLCKSAHGAGKGTAEEGKDHKRPKRPRTILTTQQRRAF    141 - 210
KASFEVSSKPCRKVRETLAAETGLSVRVVQVWFQNQRAKMKKLARRQQQQQQDQQNTQRLSSAQTNGGGS    211 - 280
AGMEGIMNPYTALPTPQQLLAIEQSVYSSDPFRQGLTPPQMPGDHMHPYGAEPLFHDLDSDDTSLSNLGD    281 - 350
CFLATSEAGPLQSRVGNPIDHLYSMQNSYFTS                                          351 - 382
//

Text Mined References (35)

PMID Year Title
26534905 2015 Polymorphisms of dopamine pathway genes NRG1 and LMX1A are associated with cognitive performance in bipolar disorder.
26526610 2015 Cell fate determination, neuronal maintenance and disease state: The emerging role of transcription factors Lmx1a and Lmx1b.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25640183 2015 Functional consequences of 17q21.31/WNT3-WNT9B amplification in hPSCs with respect to neural differentiation.
25380985 2015 Efficient differentiation of human embryonic stem cells toward dopaminergic neurons using recombinant LMX1A factor.
25099324 2014 Association of LMX1A genetic polymorphisms with susceptibility to congenital scoliosis in Chinese Han population.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24018208 2013 The role of Sp1 and EZH2 in the regulation of LMX1A in cervical cancer cells.
More...