Tbio | Elongator complex protein 5 |
Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration (By similarity). May be involved in TP53-mediated transcriptional regulation.
Comments
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 0.00321968330581497 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.012698246225107 |
group 3 medulloblastoma | 2254 | 0.0193080090471952 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.019 | 0.003 |
pancreatic ductal adenocarcinoma liver m... | -1.244 | 0.013 |
group 3 medulloblastoma | 1.300 | 0.019 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
22854966 | data identify DERP6/ELP5 and C3ORF75/ELP6 as key players for migration, invasion and tumorigenicity of melanoma cells, as integral subunits of Elongator. |
16850183 | cloning and characterization of the DERP6 gene, isolated from testis cDNA library; results indicate that the DERP6 may be involved in p53-mediated gene transcription |
MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFRE 1 - 70 GFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQ 71 - 140 VLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQASAHILCRRPRQRP 141 - 210 TDQTQWFSILPDFSLDLQEGPSVESQPYSDPHIPPVDPTTHLTFNLHLSKKEREARDSLILPFQFSSEKQ 211 - 280 QALLRPRPGQATSHIFYEPDAYDDLDQEDPDDDLDI 281 - 316 //
PMID | Year | Title |
---|---|---|
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22854966 | 2012 | DERP6 (ELP5) and C3ORF75 (ELP6) regulate tumorigenicity and migration of melanoma cells as subunits of Elongator. |
18029348 | 2008 | Toward a confocal subcellular atlas of the human proteome. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
16850183 | 2006 | Cloning and characterization of the human gene DERP6, which activates transcriptional activities of p53. |
16713569 | 2006 | A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration. |
16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
15342556 | 2004 | Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
More... |