Property Summary

NCBI Gene PubMed Count 11
PubMed Score 9.78
PubTator Score 2.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Riley-Day syndrome 11 3.608 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.300 1.9e-02
osteosarcoma -1.019 3.2e-03
pancreatic ductal adenocarcinoma liver m... -1.244 1.3e-02

Gene RIF (2)

AA Sequence

MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFRE      1 - 70
GFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQ     71 - 140
VLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQASAHILCRRPRQRP    141 - 210
TDQTQWFSILPDFSLDLQEGPSVESQPYSDPHIPPVDPTTHLTFNLHLSKKEREARDSLILPFQFSSEKQ    211 - 280
QALLRPRPGQATSHIFYEPDAYDDLDQEDPDDDLDI                                      281 - 316
//

Text Mined References (15)

PMID Year Title