Property Summary

NCBI Gene PubMed Count 32
PubMed Score 44.32
PubTator Score 27.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
gastric carcinoma 1.200 2.9e-02
intraductal papillary-mucinous adenoma (... 1.500 3.8e-04
intraductal papillary-mucinous carcinoma... 1.700 9.6e-04
malignant mesothelioma -2.200 7.5e-08
non-small cell lung cancer -1.315 1.3e-16
oligodendroglioma 1.200 6.8e-03
osteosarcoma -2.868 1.3e-06
ovarian cancer 1.400 4.8e-04
pancreatic ductal adenocarcinoma liver m... 1.689 1.3e-03
Pick disease -1.100 9.2e-04
sonic hedgehog group medulloblastoma 2.700 7.8e-07
spina bifida 1.212 3.1e-02

Gene RIF (11)

AA Sequence

MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSAKSLWTKLDKR      1 - 70
AGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGA     71 - 140
KKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVTFTGLQPPPRKGSGWRAQLQPNPPAQLANYE    141 - 210
FDVLISAAGGKFVPEGFKVREMRGKLAIGITANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGID    211 - 280
LENIVYYKDDTHYFVMTAKKQCLLRLGVLRQDWPDTNRLLGSANVVPEALQRFTRAAADFATHGKLGKLE    281 - 350
FAQDAHGQPDVSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV    351 - 420
KRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVRDLYDVLAKEP    421 - 490
VQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSEL    491 - 560
QGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSMAHSPGPVSQASPGTSS    561 - 630
AVLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALC    631 - 700
GEHLYVLERLCVNGHFFHRSCFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQTDHKAEGSDRGPESPEL    701 - 770
PTPSENSMPPGLSTPTASQEGAGPVPDPSQPTRRQIRLSSPERQRLSSLNLTPDPEMEPPPKPPRSCSAL    771 - 840
ARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPTWR    841 - 910
RTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDK    911 - 980
KNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRF    981 - 1050
QEERRLSELALGTGAQG                                                        1051 - 1067
//

Text Mined References (41)

PMID Year Title