Property Summary

NCBI Gene PubMed Count 30
Grant Count 32
R01 Count 23
Funding $4,959,100.17
PubMed Score 37.85
PubTator Score 27.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25576923 Data suggest that Sema6A and Mical1 may represent new potential therapeutic targets in BRAFV600E melanoma.
23834433 The MICAL1 directly induce oxidation of actin molecules, leading to actin depolymerization. ROS production by MICAL1 also causes oxidation of collapsin response mediator protein-2 which subsequently undergoes phosphorylation.
22331357 although MICAL1 is auto-inhibited by its C-terminal coiled-coil region, MICAL2 remains constitutively active and affects stress fibers, suggesting differential but complementary roles for MICAL1 and MICAL2 in actin microfilament regulation
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21638339 Faint and scattered immunoreactivity for Mical-1 is observed in neurons of the neocortex of the temporal lobe epilepsy group, while strong immunoreactivity for Mical-1 is shown in control subjects.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17662518 The unfolding of MICAL-1 calpolnin homology (CH) domain was studied.
12788069 MICAL-1 isoforms with their multidomain structure are novel rab1 interacting proteins that function as scaffold proteins connecting different components in the cell.
11827972 a CasL interacting molecule that associates with vimentin

AA Sequence

MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSAKSLWTKLDKR      1 - 70
AGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGA     71 - 140
KKFYGRFCTGTLDHISIRQLQLLLLKVALLLGVEIHWGVTFTGLQPPPRKGSGWRAQLQPNPPAQLANYE    141 - 210
FDVLISAAGGKFVPEGFKVREMRGKLAIGITANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGID    211 - 280
LENIVYYKDDTHYFVMTAKKQCLLRLGVLRQDWPDTNRLLGSANVVPEALQRFTRAAADFATHGKLGKLE    281 - 350
FAQDAHGQPDVSAFDFTSMMRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV    351 - 420
KRWAEGAESLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVRDLYDVLAKEP    421 - 490
VQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSEL    491 - 560
QGLGALEATAWALKVAENELGITPVVSAQAVVAGSDPLGLIAYLSHFHSAFKSMAHSPGPVSQASPGTSS    561 - 630
AVLFLSKLQRTLQRSRAKENAEDAGGKKLRLEMEAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALC    631 - 700
GEHLYVLERLCVNGHFFHRSCFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQTDHKAEGSDRGPESPEL    701 - 770
PTPSENSMPPGLSTPTASQEGAGPVPDPSQPTRRQIRLSSPERQRLSSLNLTPDPEMEPPPKPPRSCSAL    771 - 840
ARHALESSFVGWGLPVQSPQALVAMEKEEKESPFSSEEEEEDVPLDSDVEQALQTFAKTSGTMNNYPTWR    841 - 910
RTLLRRAKEEEMKRFCKAQTIQRRLNEIEAALRELEAEGVKLELALRRQSSSPEQQKKLWVGQLLQLVDK    911 - 980
KNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLKTAADRQAEDQVLRKLVDLVNQRDALIRF    981 - 1050
QEERRLSELALGTGAQG                                                        1051 - 1067
//

Text Mined References (36)

PMID Year Title
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25007825 2014 The intracellular redox protein MICAL-1 regulates the development of hippocampal mossy fibre connections.
24440334 2014 Redox modification of nuclear actin by MICAL-2 regulates SRF signaling.
23834433 2014 MICAL-family proteins: Complex regulators of the actin cytoskeleton.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22331357 2012 Differential regulation of actin microfilaments by human MICAL proteins.
22116028 2011 Direct redox regulation of F-actin assembly and disassembly by Mical.
21864500 2011 Kinetic and spectroscopic characterization of the putative monooxygenase domain of human MICAL-1.
21800438 2011 Extracellular inhibitors, repellents, and semaphorin/plexin/MICAL-mediated actin filament disassembly.
21730291 2011 MICAL-1 is a negative regulator of MST-NDR kinase signaling and apoptosis.
More...