Property Summary

NCBI Gene PubMed Count 6
PubMed Score 18.90
PubTator Score 1.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 1.400 1.2e-02
astrocytoma 1.100 4.1e-07
Astrocytoma, Pilocytic 1.200 8.1e-03
Atopic dermatitis -1.500 2.4e-04
ependymoma 1.400 4.3e-04
gastric carcinoma 1.700 1.6e-02
glioblastoma 1.400 1.2e-03
group 3 medulloblastoma 2.600 1.2e-03
intraductal papillary-mucinous adenoma (... -1.200 4.5e-03
intraductal papillary-mucinous neoplasm ... -1.400 8.1e-03
invasive ductal carcinoma -1.152 2.2e-02
oligodendroglioma 1.100 1.2e-05
ovarian cancer 1.500 1.8e-02
primary Sjogren syndrome 1.300 2.0e-03
primitive neuroectodermal tumor 1.900 9.7e-04
psoriasis -1.300 2.1e-15
ulcerative colitis 1.700 5.1e-04

Gene RIF (1)

AA Sequence

MARGDAGRGRGLLALTFCLLAARGELLLPQETTVELSCGVGPLQVILGPEQAAVLNCSLGAAAAGPPTRV      1 - 70
TWSKDGDTLLEHDHLHLLPNGSLWLSQPLAPNGSDESVPEAVGVIEGNYSCLAHGPLGVLASQTAVVKLA     71 - 140
TLADFSLHPESQTVEENGTARFECHIEGLPAPIITWEKDQVTLPEEPRLIVLPNGVLQILDVQESDAGPY    141 - 210
RCVATNSARQHFSQEALLSVAHRGSLASTRGQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQ    211 - 280
DGKPISTDVIVLGRTNLLIANAQPWHSGVYVCRANKPRTRDFATAAAELRVLAAPAITQAPEALSRTRAS    281 - 350
TARFVCRASGEPRPALRWLHNGAPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASL    351 - 420
AVVVREGLPSAPTRVTATPLSSSAVLVAWERPEMHSEQIIGFSLHYQKARGMDNVEYQFAVNNDTTELQV    421 - 490
RDLEPNTDYEFYVVAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNPSDIRVAWLPLPPSLSNGQVV    491 - 560
KYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVRISAGTAAGFGAPSQWMHHRTPSMHNQSHVP    561 - 630
FAPAELKVQAKMESLVVSWQPPPHPTQISGYKLYWREVGAEEEANGDRLPGGRGDQAWDVGPVRLKKKVK    631 - 700
QYELTQLVPGRLYEVKLVAFNKHEDGYAAVWKGKTEKAPAPDMPIQRGPPLPPAHVHAESNSSTSIWLRW    701 - 770
KKPDFTTVKIVNYTVRFSPWGLRNASLVTYYTSSGEDILIGGLKPFTKYEFAVQSHGVDMDGPFGSVVER    771 - 840
STLPDRPSTPPSDLRLSPLTPSTVRLHWCPPTEPNGEIVEYLILYSSNHTQPEHQWTLLTTQGNIFSAEV    841 - 910
HGLESDTRYFFKMGARTEVGPGPFSRLQDVITLQEKLSDSLDMHSVTGIIVGVCLGLLCLLACMCAGLRR    911 - 980
SPHRESLPGLSSTATPGNPALYSRARLGPPSPPAAHELESLVHPHPQDWSPPPSDVEDRAEVHSLMGGGV    981 - 1050
SEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKK   1051 - 1120
SPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELA   1121 - 1190
APGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA             1191 - 1250
//

Text Mined References (7)

PMID Year Title