Property Summary

NCBI Gene PubMed Count 6
PubMed Score 17.62
PubTator Score 1.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 2.05398187308836E-15
astrocytoma 1493 4.12236684934456E-7
oligodendroglioma 2849 1.17123751264357E-5
Atopic dermatitis 944 2.3667579611583E-4
posterior fossa group A ependymoma 1511 2.73811478687439E-4
ulcerative colitis 2087 5.07484951773975E-4
primitive neuroectodermal tumor 3031 9.70064322324181E-4
pediatric high grade glioma 2712 0.00100829909206402
invasive ductal carcinoma 2950 0.0010352588979016
group 3 medulloblastoma 2254 0.00120302910827462
glioblastoma 5572 0.00164595626209872
primary Sjogren syndrome 789 0.00204807480556959
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00449634665102704
pilocytic astrocytoma 3086 0.00714219459444258
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00809973099264538
gastric carcinoma 832 0.016297632535783
ovarian cancer 8492 0.0176210384471128
Disease Target Count Z-score Confidence
Premature ejaculation 16 4.342 2.2

Expression

Synonym

Accession Q8TDY8 Q9HCE4
Symbols NOPE
DDM36

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20658536 identified Nope as a novel oncofetal surface marker for murine and human HCC. Nope is specifically expressed by epithelial tumor cells but not in preneoplastic stages and is a promising marker

AA Sequence

MARGDAGRGRGLLALTFCLLAARGELLLPQETTVELSCGVGPLQVILGPEQAAVLNCSLGAAAAGPPTRV      1 - 70
TWSKDGDTLLEHDHLHLLPNGSLWLSQPLAPNGSDESVPEAVGVIEGNYSCLAHGPLGVLASQTAVVKLA     71 - 140
TLADFSLHPESQTVEENGTARFECHIEGLPAPIITWEKDQVTLPEEPRLIVLPNGVLQILDVQESDAGPY    141 - 210
RCVATNSARQHFSQEALLSVAHRGSLASTRGQDVVIVAAPENTTVVSGQSVVMECVASADPTPFVSWVRQ    211 - 280
DGKPISTDVIVLGRTNLLIANAQPWHSGVYVCRANKPRTRDFATAAAELRVLAAPAITQAPEALSRTRAS    281 - 350
TARFVCRASGEPRPALRWLHNGAPLRPNGRVKVQGGGGSLVITQIGLQDAGYYQCVAENSAGMACAAASL    351 - 420
AVVVREGLPSAPTRVTATPLSSSAVLVAWERPEMHSEQIIGFSLHYQKARGMDNVEYQFAVNNDTTELQV    421 - 490
RDLEPNTDYEFYVVAYSQLGASRTSTPALVHTLDDVPSAAPQLSLSSPNPSDIRVAWLPLPPSLSNGQVV    491 - 560
KYKIEYGLGKEDQIFSTEVRGNETQLMLNSLQPNKVYRVRISAGTAAGFGAPSQWMHHRTPSMHNQSHVP    561 - 630
FAPAELKVQAKMESLVVSWQPPPHPTQISGYKLYWREVGAEEEANGDRLPGGRGDQAWDVGPVRLKKKVK    631 - 700
QYELTQLVPGRLYEVKLVAFNKHEDGYAAVWKGKTEKAPAPDMPIQRGPPLPPAHVHAESNSSTSIWLRW    701 - 770
KKPDFTTVKIVNYTVRFSPWGLRNASLVTYYTSSGEDILIGGLKPFTKYEFAVQSHGVDMDGPFGSVVER    771 - 840
STLPDRPSTPPSDLRLSPLTPSTVRLHWCPPTEPNGEIVEYLILYSSNHTQPEHQWTLLTTQGNIFSAEV    841 - 910
HGLESDTRYFFKMGARTEVGPGPFSRLQDVITLQEKLSDSLDMHSVTGIIVGVCLGLLCLLACMCAGLRR    911 - 980
SPHRESLPGLSSTATPGNPALYSRARLGPPSPPAAHELESLVHPHPQDWSPPPSDVEDRAEVHSLMGGGV    981 - 1050
SEGRSHSKRKISWAQPSGLSWAGSWAGCELPQAGPRPALTRALLPPAGTGQTLLLQALVYDAIKGNGRKK   1051 - 1120
SPPACRNQVEAEVIVHSDFSASNGNPDLHLQDLEPEDPLPPEAPDLISGVGDPGQGAAWLDRELGGCELA   1121 - 1190
APGPDRLTCLPEAASASCSYPDLQPGEVLEETPGDSCQLKSPCPLGASPGLPRSPVSSSA             1191 - 1250
//

Text Mined References (7)

PMID Year Title
20658536 2011 Neighbor of Punc E11, a novel oncofetal marker for hepatocellular carcinoma.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10708514 2000 Cloning and expression of nope, a new mouse gene of the immunoglobulin superfamily related to guidance receptors.