Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.46
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Astrocytoma, Pilocytic 3081 6.0e-10
malignant mesothelioma 3232 2.5e-08
ulcerative colitis 1819 5.3e-05
colon cancer 1478 1.2e-04
psoriasis 6694 1.4e-03
osteosarcoma 7950 4.3e-03
lung cancer 4740 8.3e-03
active Crohn's disease 922 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
active Crohn's disease -1.087 2.3e-02
Astrocytoma, Pilocytic 1.300 6.0e-10
colon cancer -2.100 1.2e-04
lung cancer -1.300 8.3e-03
malignant mesothelioma -2.600 2.5e-08
osteosarcoma 1.243 4.3e-03
psoriasis -1.100 1.4e-03
ulcerative colitis -1.200 5.3e-05

Gene RIF (8)

AA Sequence

MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHV      1 - 70
ENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGR     71 - 140
QDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPD    141 - 210
FLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEH    211 - 280
LSRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT    281 - 350
CQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE    351 - 420
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSE    421 - 490
LLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDL    491 - 560
LSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAA    561 - 630
LYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGS    631 - 700
DSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR    701 - 770
HASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS    771 - 840
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQLLQD           841 - 903
//

Text Mined References (18)

PMID Year Title