Property Summary

NCBI Gene PubMed Count 14
Grant Count 9
R01 Count 7
Funding $738,443.12
PubMed Score 7.60
PubTator Score 11.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.600 0.000
psoriasis -1.100 0.001
osteosarcoma 1.243 0.004
lung cancer -3.100 0.000
colon cancer -2.100 0.000
active Crohn's disease -1.087 0.023
pilocytic astrocytoma 1.300 0.000
ulcerative colitis -1.400 0.000

Gene RIF (7)

PMID Text
24284654 The data, for the first time, link ASAP3 with ACTG1 in the regulation of cytoskeletal maintenance and cell motility
24078447 ). These data indicate that ASAP3 is elevated in NSCLC and may contribute to cancer development and patients' poor clinical outcome, which is possibly due to its critical roles in regulating cancer invasion.
23776207 Phosphorylation of the N-terminal region of ACAP4 (named the Bin, Amphiphysin, and RSV161/167[BAR] domain at Tyr34) is necessary for epidermal growth factor (EGF)-elicited membrane remodeling.
22027826 ACAP4 protein cooperates with Grb2 protein to orchestrate epidermal growth factor-stimulated integrin beta1 recycling in cell migration
20510928 The ArfGAP catalytic mechanism and shows a glutamine from Arf6 and an arginine fingerASAP3 as the important catalytic residues; unexpectedly the structure shows a calcium ion, liganded by both proteins in the complex interface.
18400762 ASAP3 functions nonredundantly with ASAP1 to control cell movement and may have a role in cancer cell invasion.
16737952 ACAP4 is involved in ARF6-mediated cell migration.

AA Sequence

MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVRAIHSSGLGHV      1 - 70
ENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNLNNIVSFPLDSLMKGQLRDGR     71 - 140
QDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQDMQRERRIFQLHMCEYLLKAGESQMKQGPD    141 - 210
FLQSLIKFFHAQHNFFQDGWKAAQSLFPFIEKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEH    211 - 280
LSRKNSGCGYSIHQHQGNKQFGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLT    281 - 350
CQVRPNPEEKKCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE    351 - 420
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQSLTLDLLGPSE    421 - 490
LLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRFARRCTPEPQRLWTAICNRDL    491 - 560
LSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQASLPLVDFIIQNGGHLDAKAADGNTALHYAA    561 - 630
LYNQPDCLKLLLKGRALVGTVNEAGETALDIARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGS    631 - 700
DSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR    701 - 770
HASGDRSEVSSLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS    771 - 840
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQLLQD           841 - 903
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24284654 2014 Loss of ASAP3 destabilizes cytoskeletal protein ACTG1 to suppress cancer cell migration.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
24078447 2014 ASAP3 expression in non-small cell lung cancer: association with cancer development and patients' clinical outcome.
23776207 2013 Phosphorylation of the Bin, Amphiphysin, and RSV161/167 (BAR) domain of ACAP4 regulates membrane tubulation.
22027826 2011 ACAP4 protein cooperates with Grb2 protein to orchestrate epidermal growth factor-stimulated integrin ?1 recycling in cell migration.
20510928 2010 The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism.
18400762 2008 ASAP3 is a focal adhesion-associated Arf GAP that functions in cell migration and invasion.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16737952 2006 Proteomic identification and functional characterization of a novel ARF6 GTPase-activating protein, ACAP4.
More...