Property Summary

NCBI Gene PubMed Count 56
PubMed Score 59.46
PubTator Score 61.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
malignant mesothelioma 3163 1.22732275211376E-6
atypical teratoid / rhabdoid tumor 4369 3.77250505552919E-6
Multiple myeloma 1328 0.00128560856038643
limb girdle muscular dystrophy 2B 74 0.0023900932142034
astrocytoma 1493 0.00324756192458699
ovarian cancer 8492 0.00451666733442801
hereditary spastic paraplegia 313 0.00914318594204427
sarcoidosis 368 0.00943941780545793
glioblastoma 5572 0.0169050887158646
severe Alzheimer's disease 49 0.0169811460134873
adult high grade glioma 2148 0.0182448410124415
spina bifida 1064 0.040779050638153
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Vici syndrome 16 3.604 1.8
Disease Target Count
Familial cancer of breast 12

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.719 0.001
malignant mesothelioma 1.300 0.000
astrocytoma -1.600 0.003
glioblastoma -1.300 0.017
atypical teratoid / rhabdoid tumor -1.400 0.000
hereditary spastic paraplegia -1.229 0.009
limb girdle muscular dystrophy 2B -1.004 0.002
sarcoidosis 1.100 0.009
adult high grade glioma -1.100 0.018
severe Alzheimer's disease -1.189 0.017
spina bifida -1.594 0.041
ovarian cancer 1.500 0.005

Synonym

Accession Q8TDY2 Q86YR4 Q8WVU9 Q92601
Symbols CC1
ATG17
FIP200
PPP1R131

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG

Gene RIF (40)

PMID Text
26829385 MiR-20a and miR-20b negatively regulate autophagy by targeting RB1CC1/FIP200 in breast cancer cells
26151896 RB1CC1 has been implicated in cell cycle progression, cell growth, cell proliferation, cell survival, cell spreading/migration and neurodegeneration.
24732589 RB1CC1 knockdown in PC3 cells enhances clonal growth in vitro and tumor growth in vivo.
24610824 miR-133b targeted and downregulated RB1CC1 in prostate cancer cells.
23960084 Liver-specific deficiency of FIP200 leads to chronic liver injury associated with fibrosis and inflammation.
23262492 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
22751121 The APC-independent beta-catenin degradation by FIP200 suggests a role for FIP200 in tumor suppression in the presence of APC dysfunction.
22396748 analysis of preparation of the monoclonal antibody for RB1CC1
22049074 RB1CC1 protein suppresses type II collagen synthesis in chondrocytes and causes dwarfism
21795712 RB1CC1 thus appears to play a unique role as a modulator of TGF-beta signaling by restricting substrate specificity of Arkadia.
More...

AA Sequence

MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVCTYSAGTDTNP      1 - 70
IFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQLALEMYEVAKKLCSFCEGLV     71 - 140
HDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQSIEDIKLKLTHLGTAVSVMAKIPLLECLTR    141 - 210
HSYRECLGRLDSLPEHEDSEKAEMKRSTELVLSPDMPRTTNESLLTSFPKSVEHVSPDTADAESGKEIRE    211 - 280
SCQSTVHQQDETTIDTKDGDLPFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFIAECRQT    281 - 350
IAKLDNQNMKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQL    351 - 420
MIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLERVKIVEALS    421 - 490
TVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKRLYEAEKSKRESFGKLFRKSFLRNRLFRGLDSWPP    491 - 560
SFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPLLCDFEPLHQHVLALHNLVKAAQSLDEMSQ    561 - 630
TITDLLSEQKASVSQTSPQSASSPRMESTAGITTTTSPRTPPPLTVQDPLCPAVCPLEELSPDSIDAHTF    631 - 700
DFETIPHPNIEQTIHQVSLDLDSLAESPESDFMSAVNEFVIEENLSSPNPISDPQSPEMMVESLYSSVIN    701 - 770
AIDSRRMQDTNVCGKEDFGDHTSLNVQLERCRVVAQDSHFSIQTIKEDLCHFRTFVQKEQCDFSNSLKCT    771 - 840
AVEIRNIIEKVKCSLEITLKEKHQKELLSLKNEYEGKLDGLIKETEENENKIKKLKGELVCLEEVLQNKD    841 - 910
NEFALVKHEKEAVICLQNEKDQKLLEMENIMHSQNCEIKELKQSREIVLEDLKKLHVENDEKLQLLRAEL    911 - 980
QSLEQSHLKELEDTLQVRHIQEFEKVMTDHRVSLEELKKENQQIINQIQESHAEIIQEKEKQLQELKLKV    981 - 1050
SDLSDTRCKLEVELALKEAETDEIKILLEESRAQQKETLKSLLEQETENLRTEISKLNQKIQDNNENYQV   1051 - 1120
GLAELRTLMTIEKDQCISELISRHEEESNILKAELNKVTSLHNQAFEIEKNLKEQIIELQSKLDSELSAL   1121 - 1190
ERQKDEKITQQEEKYEAIIQNLEKDRQKLVSSQEQDREQLIQKLNCEKDEAIQTALKEFKLEREVVEKEL   1191 - 1260
LEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQT   1261 - 1330
NFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPS   1331 - 1400
PYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKE   1401 - 1470
EENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDL   1471 - 1540
KPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV                   1541 - 1594
//

Text Mined References (68)

PMID Year Title
26829385 2016 MiR-20a and miR-20b negatively regulate autophagy by targeting RB1CC1/FIP200 in breast cancer cells.
26151896 2013 Duplications in RB1CC1 are associated with schizophrenia; identification in large European sample sets.
24732589 2014 Tumor-suppressive functions of 15-Lipoxygenase-2 and RB1CC1 in prostate cancer.
24610824 2014 Identification of miR-133b and RB1CC1 as independent predictors for biochemical recurrence and potential therapeutic targets for prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23960084 2013 Autophagy deficiency by hepatic FIP200 deletion uncouples steatosis from liver injury in NAFLD.
23392225 2013 FIP200 regulates targeting of Atg16L1 to the isolation membrane.
23289756 2013 The COP1 E3-ligase interacts with FIP200, a key regulator of mammalian autophagy.
23262492 2013 Interaction between FIP200 and ATG16L1 distinguishes ULK1 complex-dependent and -independent autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...