Property Summary

NCBI Gene PubMed Count 22
Grant Count 2
Funding $8,721.63
PubMed Score 17.68
PubTator Score 18.23

Knowledge Summary

Patent (1,676)

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.008
psoriasis 1.100 0.001
osteosarcoma 1.367 0.000
group 4 medulloblastoma -3.100 0.000
medulloblastoma, large-cell -1.700 0.000
breast carcinoma -1.100 0.000
fibroadenoma -1.400 0.031
lung adenocarcinoma -1.200 0.000
ovarian cancer -2.400 0.000
Down syndrome 1.600 0.001

Synonym

Accession Q8TDX7 A6NGT8
Symbols

Gene

 Grant Application (2)

PDB

2WQM   2WQN   5DE2  

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (17)

PMID Text
26642356 NEK7 serves as a cellular switch that enforces mutual exclusivity of the inflammasome response and cell division.
26522158 The C-terminal domain of Nek9 activates Nek7 through promoting back-to-back dimerization.
26188091 Nek7 increased Ser/Thr phosphorylation of Anks3 primarily within ankyrin domain.Interaction with Anks3 led to cytoplasmic retention and nuclear exclusion of Nek7.
25664600 RGS2 or Nek7 depletion or even overexpression of wild-type or kinase-dead Nek7, reduced gamma-tubulin from the mitotic spindle poles.
25280969 Results show that NEK7 was directly regulated by WHSC1 through H3K36me2 and its knockdown significantly reduced cell-cycle progression, indicating that NEK7 is a key player in the molecular pathway regulated by WHSC1.
23821772 Studies indicate that autophosphorylation of Nek7 and Plk4 occurred through an intermolecular mechanism, the kinases Aurora-A and Chk2 followed an intramolecular mechanism.
23359173 Nek7, was significantly associated with certain clinicopathologic indices in gallbladder carcinoma
23313050 Precise MT dynamic instability is critical for accurate shaping of the mitotic spindle and for cilium formation, and higher MT dynamicity is associated with tumorigenicity
22100915 NEK7 is essential for PCM accumulation in a cell cycle stage-specific manner.
21642957 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
More...

AA Sequence

MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDL      1 - 70
MDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWK     71 - 140
YFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHE    141 - 210
NGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPE    211 - 280
KRPDVTYVYDVAKRMHACTASS                                                    281 - 302
//

Text Mined References (29)

PMID Year Title
26642356 2016 NLRP3 activation and mitosis are mutually exclusive events coordinated by NEK7, a new inflammasome component.
26522158 2015 Mechanistic basis of Nek7 activation through Nek9 binding and induced dimerization.
26188091 2015 Anks3 alters the sub-cellular localization of the Nek7 kinase.
25664600 2015 Human Nek7-interactor RGS2 is required for mitotic spindle organization.
25280969 2015 WHSC1 promotes oncogenesis through regulation of NIMA-related kinase-7 in squamous cell carcinoma of the head and neck.
23821772 2013 A kinetic test characterizes kinase intramolecular and intermolecular autophosphorylation mechanisms.
23359173 2013 The expression of Nek7, FoxM1, and Plk1 in gallbladder cancer and their relationships to clinicopathologic features and survival.
23313050 2013 Nek7 kinase accelerates microtubule dynamic instability.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22100915 2011 NEK7 is essential for centriole duplication and centrosomal accumulation of pericentriolar material proteins in interphase cells.
More...