Property Summary

Ligand Count 1
NCBI Gene PubMed Count 29
PubMed Score 20.82
PubTator Score 18.23

Knowledge Summary

Patent (1,676)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (10)

Disease log2 FC p
breast carcinoma -1.100 3.3e-04
Down syndrome 1.600 5.9e-04
fibroadenoma -1.400 3.1e-02
group 3 medulloblastoma -1.200 1.8e-02
lung adenocarcinoma -1.200 8.1e-10
medulloblastoma, large-cell -1.700 1.3e-04
osteosarcoma 1.367 2.9e-04
ovarian cancer -2.400 3.7e-09
psoriasis 1.100 8.6e-04
Rheumatoid arthritis 1.400 7.8e-03

 GWAS Trait (1)

Gene RIF (22)

AA Sequence

MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVALKKVQIFDL      1 - 70
MDAKARADCIKEIDLLKQLNHPNVIKYYASFIEDNELNIVLELADAGDLSRMIKHFKKQKRLIPERTVWK     71 - 140
YFVQLCSALEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSKTTAAHSLVGTPYYMSPERIHE    141 - 210
NGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLYSLCKKIEQCDYPPLPSDHYSEELRQLVNMCINPDPE    211 - 280
KRPDVTYVYDVAKRMHACTASS                                                    281 - 302
//

Text Mined References (36)

PMID Year Title