Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.12
PubTator Score 14.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q8TDX6 B2RBE4 Q6P9G6 Q8IUF9 Q9NSQ7 Q9NUM9 CsGalNAcT-1
Symbols ChGn
CSGalNAcT-1
beta4GalNAcT

Gene

PANTHER Protein Class (2)

Gene RIF (8)

PMID Text
23748413 CSGalNAcT-1 and Hapln-1 may play important roles in the pathogenesis of Kashin-Beck disease and osteoarthritis.
22156920 CSGalNAcT-1 exhibited higher enzymatic efficiency toward monosulfated trisaccharides substituted at C4 or C6 position of Gal1, and at C6 of Gal2 compared with the unsulfated oligosaccharide.
21160489 CSGALNACT1 missense mutations are associated with neuropathies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19701759 higher expression in the fetal skin than in adult skin
12446672 plays a role in the initiation and elongation in the synthesis of chondroitin sulfate
12163485 These results suggest that this enzyme has N-acetylgalactosaminyltransferase activity in both the elongation and initiation of chondroitin sulfate synthesis.

AA Sequence

MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRN      1 - 70
YVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLA     71 - 140
TEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDELVEAIESALETLNSPAENSPNHRPYTASDFI    141 - 210
EGIYRTERDKGTLYELTFKGDHKHEFKRLILFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFM    211 - 280
QNFREMCIEQDGRVHLTVVYFGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGS    281 - 350
NVLLFFCDVDIYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD    351 - 420
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKRCMDELTPEQY    421 - 490
KMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT                                491 - 532
//

Text Mined References (20)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
23748413 2013 Abnormal expression of chondroitin sulphate N-acetylgalactosaminyltransferase 1 and Hapln-1 in cartilage with Kashin-Beck disease and primary osteoarthritis.
23726668 2013 A genome-wide association study of a sustained pattern of antidepressant response.
22156920 2012 Chondroitin sulfate N-acetylgalactosaminyltransferase-1 (CSGalNAcT-1) involved in chondroitin sulfate initiation: Impact of sulfation on activity and specificity.
21160489 2011 Chondroitin beta-1,4-N-acetylgalactosaminyltransferase-1 missense mutations are associated with neuropathies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19701759 2010 Comparison between human fetal and adult skin.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17145758 2007 Chondroitin sulfate N-acetylgalactosaminyltransferase-1 plays a critical role in chondroitin sulfate synthesis in cartilage.
More...