Property Summary

NCBI Gene PubMed Count 39
PubMed Score 29.71
PubTator Score 14.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
aldosterone-producing adenoma -1.410 1.8e-02
atypical teratoid / rhabdoid tumor -3.600 5.7e-07
autosomal dominant Emery-Dreifuss muscul... 1.122 4.4e-03
Breast cancer -1.400 1.8e-04
Chronic Lymphocytic Leukemia -3.513 8.8e-09
cystic fibrosis 1.323 5.9e-03
Duchenne muscular dystrophy 1.476 6.8e-08
glioblastoma -1.600 1.9e-02
group 3 medulloblastoma -3.400 3.6e-05
lung adenocarcinoma -1.022 1.2e-03
lung cancer -1.800 2.6e-03
malignant mesothelioma -5.700 4.2e-09
medulloblastoma, large-cell -5.300 1.3e-06
non-small cell lung cancer -1.325 2.3e-11
ovarian cancer -4.600 2.8e-14
pituitary cancer -1.800 2.1e-04
posterior fossa group A ependymoma -1.300 7.3e-05
Rheumatoid arthritis 1.400 2.7e-02
ulcerative colitis 2.800 2.1e-05

Gene RIF (9)

AA Sequence

MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRN      1 - 70
YVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLA     71 - 140
TEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDELVEAIESALETLNSPAENSPNHRPYTASDFI    141 - 210
EGIYRTERDKGTLYELTFKGDHKHEFKRLILFRPFGPIMKVKNEKLNMANTLINVIVPLAKRVDKFRQFM    211 - 280
QNFREMCIEQDGRVHLTVVYFGKEEINEVKGILENTSKAANFRNFTFIQLNGEFSRGKGLDVGARFWKGS    281 - 350
NVLLFFCDVDIYFTSEFLNTCRLNTQPGKKVFYPVLFSQYNPGIIYGHHDAVPPLEQQLVIKKETGFWRD    351 - 420
FGFGMTCQYRSDFINIGGFDLDIKGWGGEDVHLYRKYLHSNLIVVRTPVRGLFHLWHEKRCMDELTPEQY    421 - 490
KMCMQSKAMNEASHGQLGMLVFRHEIEAHLRKQKQKTSSKKT                                491 - 532
//

Text Mined References (41)

PMID Year Title