Property Summary

NCBI Gene PubMed Count 16
PubMed Score 44.21
PubTator Score 17.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1962 1.5e-03
ependymoma 4679 1.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Parkinson's disease 392 0.0 2.4
Disease Target Count Z-score Confidence
Pellagra 26 3.996 2.0
Primary syphilis 4 3.325 1.7
Latent syphilis 3 3.197 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 1.100 1.8e-03
pancreatic ductal adenocarcinoma liver m... -3.251 1.5e-03

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MKIDIHSHILPKEWPDLKKRFGYGGWVQLQHHSKGEAKLLKDGKVFRVVRENCWDPEVRIREMDQKGVTV      1 - 70
QALSTVPVMFSYWAKPEDTLNLCQLLNNDLASTVVSYPRRFVGLGTLPMQAPELAVKEMERCVKELGFPG     71 - 140
VQIGTHVNEWDLNAQELFPVYAAAERLKCSLFVHPWDMQMDGRMAKYWLPWLVGMPAETTIAICSMIMGG    141 - 210
VFEKFPKLKVCFAHGGGAFPFTVGRISHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDV    211 - 280
IGKDKVILGTDYPFPLGELEPGKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE                  281 - 336
//

Text Mined References (17)

PMID Year Title