Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.73
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
glioblastoma multiforme 347 8.69711374194427E-17
medulloblastoma 1524 3.04247507995702E-7
atypical teratoid / rhabdoid tumor 4369 3.05436243147751E-5
adrenocortical carcinoma 1427 7.60360403200901E-5
interstitial cystitis 2299 6.44692746018537E-4
medulloblastoma, large-cell 6234 6.45809507680495E-4
nasopharyngeal carcinoma 1056 0.00238626679871285
astrocytic glioma 2241 0.00366170422733105
oligodendroglioma 2849 0.00505405423062591
ependymoma 2514 0.00799182866320317
Breast cancer 3099 0.00999605758796989
osteosarcoma 7933 0.0102390327540185
adult high grade glioma 2148 0.0250381253232482
spina bifida 1064 0.0456135347081227

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.400 0.004
ependymoma -2.400 0.008
oligodendroglioma -2.200 0.005
glioblastoma multiforme -1.400 0.000
osteosarcoma 1.553 0.010
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.700 0.001
adrenocortical carcinoma -2.841 0.000
interstitial cystitis -1.800 0.001
adult high grade glioma -1.400 0.025
Breast cancer 1.800 0.010
nasopharyngeal carcinoma -1.200 0.002
spina bifida -1.969 0.046

Synonym

Accession Q8TDW5 A2RRF2
Symbols slp5

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
16630545 These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins.
12051743 molecular cloning of slp5:a novel Rab27A effector with C-terminal tandem C2 domains
12051743 Synaptotagmin-like protein 5 (Slp5) contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp5 specifically and directly binds the GTP-bound form of Rab27A.

AA Sequence

MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQEASRVCVHCHRN      1 - 70
LGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVR     71 - 140
QSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSY    141 - 210
SLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYG    211 - 280
FENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSIRSKSVPG    281 - 350
ALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKT    351 - 420
GGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTISHTQLETRT    421 - 490
LQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQYKGELTVVLRYIPPEENL    491 - 560
MLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLV    561 - 630
IKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEE    631 - 700
QRLWQKMANNPGTPFEGVLMLRSSMGKCRL                                            701 - 730
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23568457 2013 Genetic variants associated with disordered eating.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
16630545 2006 Rab27a regulates epithelial sodium channel (ENaC) activity through synaptotagmin-like protein (SLP-5) and Munc13-4 effector mechanism.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051743 2002 Synaptotagmin-like protein 5: a novel Rab27A effector with C-terminal tandem C2 domains.