Property Summary

NCBI Gene PubMed Count 6
Grant Count 1
Funding $73,000
PubMed Score 2.73
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.400 0.004
ependymoma -2.400 0.008
oligodendroglioma -2.200 0.005
glioblastoma multiforme -1.400 0.000
osteosarcoma 1.553 0.010
medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.700 0.001
adrenocortical carcinoma -2.841 0.000
interstitial cystitis -1.800 0.001
adult high grade glioma -1.400 0.025
Breast cancer 1.800 0.010
nasopharyngeal carcinoma -1.200 0.002
spina bifida -1.969 0.046

Synonym

Accession Q8TDW5 A2RRF2
Symbols slp5

Gene

 Grant Application (1)

Gene RIF (3)

PMID Text
16630545 These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins.
12051743 molecular cloning of slp5:a novel Rab27A effector with C-terminal tandem C2 domains
12051743 Synaptotagmin-like protein 5 (Slp5) contains an N-terminal Slp homology domain (SHD) (PMID: 11327731). The SHD of Slp5 specifically and directly binds the GTP-bound form of Rab27A.

AA Sequence

MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQEASRVCVHCHRN      1 - 70
LGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVR     71 - 140
QSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSY    141 - 210
SLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYG    211 - 280
FENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSIRSKSVPG    281 - 350
ALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKT    351 - 420
GGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTISHTQLETRT    421 - 490
LQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQYKGELTVVLRYIPPEENL    491 - 560
MLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLV    561 - 630
IKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEE    631 - 700
QRLWQKMANNPGTPFEGVLMLRSSMGKCRL                                            701 - 730
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23568457 2013 Genetic variants associated with disordered eating.
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
16630545 2006 Rab27a regulates epithelial sodium channel (ENaC) activity through synaptotagmin-like protein (SLP-5) and Munc13-4 effector mechanism.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12051743 2002 Synaptotagmin-like protein 5: a novel Rab27A effector with C-terminal tandem C2 domains.