Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.73
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -2.841 7.6e-05
adult high grade glioma -1.400 2.5e-02
astrocytic glioma -2.400 3.7e-03
atypical teratoid / rhabdoid tumor -2.100 3.1e-05
Breast cancer 1.800 1.0e-02
ependymoma -2.400 8.0e-03
glioblastoma multiforme -1.400 8.7e-17
group 3 medulloblastoma -2.500 1.6e-03
interstitial cystitis -1.600 2.0e-02
medulloblastoma, large-cell -2.700 6.5e-04
nasopharyngeal carcinoma -1.200 2.4e-03
oligodendroglioma -2.200 5.1e-03
osteosarcoma 1.553 1.0e-02
spina bifida -1.969 4.6e-02

Gene RIF (3)

AA Sequence

MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTQQEASRVCVHCHRN      1 - 70
LGLIFDRGDPCQACSLRVCRECRVAGPNGSWKCTVCDKIAQLRIITGEWFFEEKAKRFKQVNVLGTDVVR     71 - 140
QSILRRSPGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRGEIITPKTDTGRSY    141 - 210
SLDLDGQHFRSLKSPPGSDRGSTGSSDLNDQEPGPRTPKSSRSNGVTPGTQSSPAPSTRTVTSVISREYG    211 - 280
FENSMDLAAIEGTSQELTKSHRRNTSGTPSIAVSGTSLSSDQSRSELDLSESFTEDSEDTVSIRSKSVPG    281 - 350
ALDKDSLEETEESIDALVSSQLSTNTHRLASGLSTTSLNSMMSVYSETGDYGNVKVSGEILLHISYCYKT    351 - 420
GGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTISHTQLETRT    421 - 490
LQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQYKGELTVVLRYIPPEENL    491 - 560
MLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLV    561 - 630
IKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEE    631 - 700
QRLWQKMANNPGTPFEGVLMLRSSMGKCRL                                            701 - 730
//

Text Mined References (8)

PMID Year Title