Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $32,177.62
PubMed Score 23.70
PubTator Score 6.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma -2.200 0.000
psoriasis -3.600 0.000
osteosarcoma -1.392 0.000
cystic fibrosis -1.489 0.000
medulloblastoma, large-cell 1.300 0.001

Gene RIF (1)

PMID Text
23142218 miR-24 is a direct regulator of ST7L.

AA Sequence

MADRGGVGEAAAVGASPASVPGLNPTLGWRERLRAGLAGTGASLWFVAGLGLLYALRIPLRLCENLAAVT      1 - 70
VFLNSLTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQPLMGGTESSISEPGSPSRNR     71 - 140
ENETSRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLTYYDMNLSAQDHQTFFTCDTDFLRPSDTVMQ    141 - 210
KAWRERNPPARIKAAYQALELNNDCATAYVLLAEEEATTIVDAERLFKQALKAGETIYRQSQQCQHQSPQ    211 - 280
HEAQLRRDTNVLVYIKRRLAMCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQA    281 - 350
VLAKYDDISLPKSAAICYTAALLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEM    351 - 420
KSLILPPEHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWEGTFRMIPYPLEKGHLFYPYPSCTETA    421 - 490
DRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAMIAILTHQFPEIMGIFAKAVLGLWCPQPWASSGFEE    491 - 560
NTQDLKSEDLGLSSG                                                           561 - 575
//

Text Mined References (11)

PMID Year Title
23142218 2013 MiR-24 regulates the proliferation and invasion of glioma by ST7L via ?-catenin/Tcf-4 signaling.
21572416 2011 Meta-analysis of genome-wide association studies identifies common variants associated with blood pressure variation in east Asians.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12063568 2002 Expression of ST7R (ST7-like, ST7L) in normal tissues and cancer.
12012006 2002 Molecular cloning and characterization of ST7R (ST7-like, ST7L) on human chromosome 1p13, a novel gene homologous to tumor suppressor gene ST7 on human chromosome 7q31.
More...