Property Summary

NCBI Gene PubMed Count 9
PubMed Score 27.26
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 1.4e-07
osteosarcoma 7950 1.8e-06
psoriasis 6694 3.8e-06
medulloblastoma, large-cell 6241 4.5e-05
cystic fibrosis 1696 4.0e-04
Disease Target Count Z-score Confidence
Burning mouth syndrome 7 3.517 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
cystic fibrosis -1.286 4.0e-04
malignant mesothelioma -2.200 1.4e-07
medulloblastoma, large-cell 1.100 4.5e-05
osteosarcoma -1.392 1.8e-06
psoriasis -3.600 3.8e-06

Gene RIF (2)

AA Sequence

MADRGGVGEAAAVGASPASVPGLNPTLGWRERLRAGLAGTGASLWFVAGLGLLYALRIPLRLCENLAAVT      1 - 70
VFLNSLTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQPLMGGTESSISEPGSPSRNR     71 - 140
ENETSRQNLSECKVWRNPLNLFRGAEYRRYTWVTGKEPLTYYDMNLSAQDHQTFFTCDTDFLRPSDTVMQ    141 - 210
KAWRERNPPARIKAAYQALELNNDCATAYVLLAEEEATTIVDAERLFKQALKAGETIYRQSQQCQHQSPQ    211 - 280
HEAQLRRDTNVLVYIKRRLAMCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQA    281 - 350
VLAKYDDISLPKSAAICYTAALLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEM    351 - 420
KSLILPPEHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWEGTFRMIPYPLEKGHLFYPYPSCTETA    421 - 490
DRELLPTFHHVSVYPKKELPLFIHFTAGFCSSTAMIAILTHQFPEIMGIFAKAVLGLWCPQPWASSGFEE    491 - 560
NTQDLKSEDLGLSSG                                                           561 - 575
//

Text Mined References (12)

PMID Year Title