Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.50
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 2.80073322351671E-12
cystic fibrosis 1670 1.4915420476584E-6
tuberculosis 1563 2.13978179369028E-5
interstitial cystitis 2299 2.78587722429039E-5
ulcerative colitis 2087 4.41594358824153E-5
osteosarcoma 7933 5.67790847712596E-4
medulloblastoma, large-cell 6234 0.00127800095489969
ductal carcinoma in situ 1745 0.00159684089798262
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00171211284649109
group 3 medulloblastoma 2254 0.00181750747575385
invasive ductal carcinoma 2950 0.00186897264997825
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00266518912383907
astrocytic glioma 2241 0.00483785729433774
oligodendroglioma 2849 0.00732299939535494
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0216541854445561
sarcoidosis 368 0.0222274174202471
ependymoma 2514 0.0407118209572497

Expression

  Differential Expression (17)

Synonym

Accession Q8TDW0 B3KXS9 Q29RV6 Q9H075
Symbols AD158
FAD158

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15184384 fad158 has a role in regulating adipocyte differentiation
15094057 identified four genes, named TA-LRRP, AD158, LRRC5, and FLJ23420, as unknown LRRC8-like genes

AA Sequence

MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQPAQNHSSLSN      1 - 70
VSQAVASTTPLPPPKPSPANPITVEMKGLKTDLDLQQYSFINQMCYERALHWYAKYFPYLVLIHTLVFML     71 - 140
CSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSGEDSEEKDNRKNNMNRSNTIQSGPEDSLVNS    141 - 210
QSLKSIPEKFVVDKSTAGALDKKEGEQAKALFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYN    211 - 280
SALVSKVQFTVDCNVDIQDMTGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYS    281 - 350
FEYVRQETGIDDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT    351 - 420
NAHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVKIHSAALSFLK    421 - 490
ENLKVLSVKFDDMRELPPWMYGLRNLEELYLVGSLSHDISRNVTLESLRDLKSLKILSIKSNVSKIPQAV    491 - 560
VDVSSHLQKMCIHNDGTKLVMLNNLKKMTNLTELELVHCDLERIPHAVFSLLSLQELDLKENNLKSIEEI    561 - 630
VSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPP    631 - 700
EIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPE    701 - 770
LGDCRALKRAGLVVEDALFETLPSDVREQMKTE                                         771 - 803
//

Text Mined References (15)

PMID Year Title
26824658 2016 LRRC8 Proteins Form Volume-Regulated Anion Channels that Sense Ionic Strength.
24790029 2014 Identification of LRRC8 heteromers as an essential component of the volume-regulated anion channel VRAC.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22532330 2012 LRRC8 proteins share a common ancestor with pannexins, and may form hexameric channels involved in cell-cell communication.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15564382 2004 Fad24, a mammalian homolog of Noc3p, is a positive regulator in adipocyte differentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...