Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.90
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.500 4.8e-03
cystic fibrosis 1.384 6.6e-05
ductal carcinoma in situ -1.200 1.6e-03
ependymoma -1.100 4.1e-02
group 3 medulloblastoma -1.300 6.2e-03
interstitial cystitis 1.300 1.2e-03
intraductal papillary-mucinous adenoma (... -1.400 1.7e-03
intraductal papillary-mucinous carcinoma... -1.600 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.200 2.2e-02
invasive ductal carcinoma -1.400 5.9e-03
medulloblastoma, large-cell -2.000 1.3e-03
oligodendroglioma -1.400 7.3e-03
osteosarcoma 1.805 5.7e-04
ovarian cancer 1.900 2.8e-12
sarcoidosis 1.100 2.2e-02
tuberculosis -1.200 2.1e-05
ulcerative colitis 2.100 4.4e-05

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MIPVTEFRQFSEQQPAFRVLKPWWDVFTDYLSVAMLMIGVFGCTLQVMQDKIICLPKRVQPAQNHSSLSN      1 - 70
VSQAVASTTPLPPPKPSPANPITVEMKGLKTDLDLQQYSFINQMCYERALHWYAKYFPYLVLIHTLVFML     71 - 140
CSNFWFKFPGSSSKIEHFISILGKCFDSPWTTRALSEVSGEDSEEKDNRKNNMNRSNTIQSGPEDSLVNS    141 - 210
QSLKSIPEKFVVDKSTAGALDKKEGEQAKALFEKVKKFRLHVEEGDILYAMYVRQTVLKVIKFLIIIAYN    211 - 280
SALVSKVQFTVDCNVDIQDMTGYKNFSCNHTMAHLFSKLSFCYLCFVSIYGLTCLYTLYWLFYRSLREYS    281 - 350
FEYVRQETGIDDIPDVKNDFAFMLHMIDQYDPLYSKRFAVFLSEVSENKLKQLNLNNEWTPDKLRQKLQT    351 - 420
NAHNRLELPLIMLSGLPDTVFEITELQSLKLEIIKNVMIPATIAQLDNLQELSLHQCSVKIHSAALSFLK    421 - 490
ENLKVLSVKFDDMRELPPWMYGLRNLEELYLVGSLSHDISRNVTLESLRDLKSLKILSIKSNVSKIPQAV    491 - 560
VDVSSHLQKMCIHNDGTKLVMLNNLKKMTNLTELELVHCDLERIPHAVFSLLSLQELDLKENNLKSIEEI    561 - 630
VSFQHLRKLTVLKLWHNSITYIPEHIKKLTSLERLSFSHNKIEVLPSHLFLCNKIRYLDLSYNDIRFIPP    631 - 700
EIGVLQSLQYFSITCNKVESLPDELYFCKKLKTLKIGKNSLSVLSPKIGNLLFLSYLDVKGNHFEILPPE    701 - 770
LGDCRALKRAGLVVEDALFETLPSDVREQMKTE                                         771 - 803
//

Text Mined References (15)

PMID Year Title