Property Summary

NCBI Gene PubMed Count 7
Grant Count 8
R01 Count 8
Funding $538,497.66
PubMed Score 135.89
PubTator Score 32.13

Knowledge Summary

Patent (9,561)

Gene RIF (1)

PMID Text
22543972 Small rare recurrent deletions and reciprocal duplications in 2q21.1, including brain-specific GPR148

AA Sequence

MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLL      1 - 70
LVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMACGILTDAVFAACTSTILSFT     71 - 140
AIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFPTFLIWLSKWQDAQLEEQGASYILPPSMGTQ    141 - 210
PGCGLLVIVTYTSILCVLFLCTALIANCFWRIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVF    211 - 280
SLDMVLTRYHHIDSGTHTWLLAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS       281 - 347
//

Text Mined References (8)

PMID Year Title
22543972 2012 Small rare recurrent deletions and reciprocal duplications in 2q21.1, including brain-specific ARHGEF4 and GPR148.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15688318 2004 A novel human G protein-coupled receptor is over-expressed in prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.