Property Summary

NCBI Gene PubMed Count 3
Grant Count 3
R01 Count 3
Funding $112,696
PubMed Score 4.55
PubTator Score 1.37

Knowledge Summary

Patent (3,203)

Gene RIF (1)

PMID Text
15111018 Northern blot analysis reveals expression of galanin-receptor like (GalRL) in the central nervous system with minor levels in peripheral organs and tissues, such as testis, liver, kidney and stomach.

AA Sequence

MLAAAFADSNSSSMNVSFAHLHFAGGYLPSDSQDWRTIIPALLVAVCLVGFVGNLCVIGILLHNAWKGKP      1 - 70
SMIHSLILNLSLADLSLLLFSAPIRATAYSKSVWDLGWFVCKSSDWFIHTCMAAKSLTIVVVAKVCFMYA     71 - 140
SDPAKQVSIHNYTIWSVLVAIWTVASLLPLPEWFFSTIRHHEGVEMCLVDVPAVAEEFMSMFGKLYPLLA    141 - 210
FGLPLFFASFYFWRAYDQCKKRGTKTQNLRNQIRSKQVTVMLLSIAIISALLWLPEWVAWLWVWHLKAAG    211 - 280
PAPPQGFIALSQVLMFSISSANPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKV    281 - 350
PSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK     351 - 419
//

Text Mined References (3)

PMID Year Title
15111018 2004 Cloning and characterization of a novel G-protein-coupled receptor with homology to galanin receptors.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.