Property Summary

NCBI Gene PubMed Count 3
PubMed Score 4.55
PubTator Score 1.37

Knowledge Summary

Patent (3,203)

Synonym

Accession Q8TDV0 Q86SN8 Q8NGV2
Symbols GPCR
PGR7
GALR4
GALRL

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gene RIF (1)

PMID Text
15111018 Northern blot analysis reveals expression of galanin-receptor like (GalRL) in the central nervous system with minor levels in peripheral organs and tissues, such as testis, liver, kidney and stomach.

AA Sequence

MLAAAFADSNSSSMNVSFAHLHFAGGYLPSDSQDWRTIIPALLVAVCLVGFVGNLCVIGILLHNAWKGKP      1 - 70
SMIHSLILNLSLADLSLLLFSAPIRATAYSKSVWDLGWFVCKSSDWFIHTCMAAKSLTIVVVAKVCFMYA     71 - 140
SDPAKQVSIHNYTIWSVLVAIWTVASLLPLPEWFFSTIRHHEGVEMCLVDVPAVAEEFMSMFGKLYPLLA    141 - 210
FGLPLFFASFYFWRAYDQCKKRGTKTQNLRNQIRSKQVTVMLLSIAIISALLWLPEWVAWLWVWHLKAAG    211 - 280
PAPPQGFIALSQVLMFSISSANPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKV    281 - 350
PSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK     351 - 419
//

Text Mined References (3)

PMID Year Title
15111018 2004 Cloning and characterization of a novel G-protein-coupled receptor with homology to galanin receptors.
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.