Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.33
PubTator Score 13.04

Knowledge Summary

Patent (4,659)

Expression

Synonym

Accession Q8TDU9 B0M0L4 Q3MJB1 Q8NGZ8 RLN3 receptor 2
Symbols GPR100
RLN3R2
RXFPR4
GPCR142

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (6)

PMID Text
25043977 electrostatic interactions between INSL5 and RXFP4
24802387 Mutant relaxin-3 shows a significant decrease in receptor-activation potency towards RXFP4.
18582868 the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation.
15525639 INSL5 is an endogenous ligand for GPCR142
15465925 Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142.
14522967 relaxin-3/INSL7 is a ligand for GPCR142 [GPCR142]

AA Sequence

MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARR      1 - 70
APGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARY     71 - 140
WVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVV    141 - 210
LAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWN    211 - 280
STFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRR    281 - 350
WVASNPRESRPSTLLTNLDRGTPG                                                  351 - 374
//

Text Mined References (16)

PMID Year Title
25043977 2014 Identification of important residues of insulin-like peptide 5 and its receptor RXFP4 for ligand-receptor interactions.
24802387 2014 The electrostatic interactions of relaxin-3 with receptor RXFP4 and the influence of its B-chain C-terminal conformation.
18582868 2008 Identification of the domains in RXFP4 (GPCR142) responsible for the high affinity binding and agonistic activity of INSL5 at RXFP4 compared to RXFP3 (GPCR135).
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16507880 2006 International Union of Pharmacology LVII: recommendations for the nomenclature of receptors for relaxin family peptides.
15956688 2005 Receptors for relaxin family peptides.
15525639 2005 INSL5 is a high affinity specific agonist for GPCR142 (GPR100).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15465925 2005 Relaxin-3/insulin-like peptide 5 chimeric peptide, a selective ligand for G protein-coupled receptor (GPCR)135 and GPCR142 over leucine-rich repeat-containing G protein-coupled receptor 7.
More...