Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.61
PubTator Score 13.04

Knowledge Summary

Patent (4,659)

Expression

Gene RIF (9)

AA Sequence

MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARR      1 - 70
APGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARY     71 - 140
WVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVV    141 - 210
LAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWN    211 - 280
STFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRR    281 - 350
WVASNPRESRPSTLLTNLDRGTPG                                                  351 - 374
//

Text Mined References (19)

PMID Year Title