Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
16620963 Inhibition of Protein Kinase C represents a mechanism by which high tyrosine kinase activity can enhance cellular Ca(2+) transients and thus exert profound effects on the proliferation, apoptosis and chemotaxis of leukemic cells.

AA Sequence

MEMTKLFSYIVIKNVYYPQVSFGISANTFLLLFHIFTFAYTHRLKPIDMTISHLPLIHILLLFTQAILVS      1 - 70
SDLFESWNIQNNDLKCKIITFLNRVMRGVSICTTCLLSVLQAITISPSTSFLEKFKHISANHTLGFILFS     71 - 140
WVLNMFITNNLLLFIVPTPNRIGASLLFVTEHCYVLPMSYTHRSLFFILMVLRDVIFIGLMVLSSGYG      141 - 208
//

Text Mined References (3)

PMID Year Title
19952141 2010 Extreme variability among mammalian V1R gene families.
16620963 2006 Tyrosine kinase modulation of protein kinase C activity regulates G protein-linked Ca2+ signaling in leukemic hematopoietic cells.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.