Property Summary

NCBI Gene PubMed Count 5
PubMed Score 39.00
PubTator Score 17.64

Knowledge Summary

Patent (1,058)

TINX Plot

  Disease Relevance (1)

Synonym

Accession Q8TDT2 Q0VD88 Q86SM0
Symbols PGR5

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

AA Sequence

MDTTMEADLGATGHRPRTELDDEDSYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARHGAGTRLALLL      1 - 70
LSLALSDFLFLAAAAFQILEIRHGGHWPLGTAACRFYYFLWGVSYSSGLFLLAALSLDRCLLALCPHWYP     71 - 140
GHRPVRLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLVICLDFWDSEELSLRMLEVLGGFLPFLLLLV    141 - 210
CHVLTQATACRTCHRQQQPAACRGFARVARTILSAYVVLRLPYQLAQLLYLAFLWDVYSGYLLWEALVYS    211 - 280
DYLILLNSCLSPFLCLMASADLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQS    281 - 350
QMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAAS    351 - 420
SVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT                        421 - 470
//

Text Mined References (5)

PMID Year Title
15777626 2005 Nine new human Rhodopsin family G-protein coupled receptors: identification, sequence characterisation and evolutionary relationship.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12679517 2003 The G protein-coupled receptor repertoires of human and mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.