Property Summary

NCBI Gene PubMed Count 5
PubMed Score 41.78
PubTator Score 17.64

Knowledge Summary

Patent (1,058)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
estrogen-receptor positive breast cancer 6 3.629 1.8

AA Sequence

MDTTMEADLGATGHRPRTELDDEDSYPQGGWDTVFLVALLLLGLPANGLMAWLAGSQARHGAGTRLALLL      1 - 70
LSLALSDFLFLAAAAFQILEIRHGGHWPLGTAACRFYYFLWGVSYSSGLFLLAALSLDRCLLALCPHWYP     71 - 140
GHRPVRLPLWVCAGVWVLATLFSVPWLVFPEAAVWWYDLVICLDFWDSEELSLRMLEVLGGFLPFLLLLV    141 - 210
CHVLTQATACRTCHRQQQPAACRGFARVARTILSAYVVLRLPYQLAQLLYLAFLWDVYSGYLLWEALVYS    211 - 280
DYLILLNSCLSPFLCLMASADLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQS    281 - 350
QMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQPQSDPTAQPQLNLMAQPQSDSVAQPQADTNVQTPAPAAS    351 - 420
SVPSPCDEASPTPSSHPTPGALEDPATPPASEGESPSSTPPEAAPGAGPT                        421 - 470
//

Text Mined References (5)

PMID Year Title