Property Summary

NCBI Gene PubMed Count 8
Grant Count 29
R01 Count 10
Funding $6,994,713.15
PubMed Score 39.48
PubTator Score 9.70

Knowledge Summary

Patent (2,077)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Meningitis 46 3.301 1.7

Expression

Gene RIF (3)

PMID Text
23446738 Heptapeptide alamandine acts through Mas-related G-protein-coupled receptor member D producing physiological actions that resemble those generated by angiotensin-1-7.
22715397 MRGD could be involved in tumorigenesis and could also be a novel anticancer drug target.
18636314 Mas, MrgD, and MRG mediated Ang IV-stimulated AA release that was highest for Mas. While Ang III activated Mas and MrgX2, Ang II stimulated AA release via Mas and MRG.

AA Sequence

MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAA      1 - 70
ADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRH     71 - 140
LSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQ    141 - 210
QWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVG    211 - 280
SRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA                                 281 - 321
//

Text Mined References (8)

PMID Year Title
23446738 2013 Discovery and characterization of alamandine: a novel component of the renin-angiotensin system.
22715397 2012 MRGD, a MAS-related G-protein coupled receptor, promotes tumorigenisis and is highly expressed in lung cancer.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
18636314 2008 Angiotensin metabolites can stimulate receptors of the Mas-related genes family.
15037633 2004 Identification of a G protein-coupled receptor specifically responsive to beta-alanine.
12909716 2003 Atypical expansion in mice of the sensory neuron-specific Mrg G protein-coupled receptor family.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.