Property Summary

NCBI Gene PubMed Count 8
PubMed Score 39.48
PubTator Score 9.70

Knowledge Summary

Patent (2,077)

TINX Plot

  Disease Sources (1)

Disease Target Count Z-score Confidence
Meningitis 46 3.301 1.7

Expression

Synonym

Accession Q8TDS7 Q8NGK7
Symbols MRGD
TGR7

Gene

PANTHER Protein Class (2)

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum EggNOG Inparanoid

  TechDev Info (1)

Gene RIF (3)

PMID Text
23446738 Heptapeptide alamandine acts through Mas-related G-protein-coupled receptor member D producing physiological actions that resemble those generated by angiotensin-1-7.
22715397 MRGD could be involved in tumorigenesis and could also be a novel anticancer drug target.
18636314 Mas, MrgD, and MRG mediated Ang IV-stimulated AA release that was highest for Mas. While Ang III activated Mas and MrgX2, Ang II stimulated AA release via Mas and MRG.

AA Sequence

MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAA      1 - 70
ADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRH     71 - 140
LSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQ    141 - 210
QWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVG    211 - 280
SRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA                                 281 - 321
//

Text Mined References (8)

PMID Year Title
23446738 2013 Discovery and characterization of alamandine: a novel component of the renin-angiotensin system.
22715397 2012 MRGD, a MAS-related G-protein coupled receptor, promotes tumorigenisis and is highly expressed in lung cancer.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
18636314 2008 Angiotensin metabolites can stimulate receptors of the Mas-related genes family.
15037633 2004 Identification of a G protein-coupled receptor specifically responsive to beta-alanine.
12909716 2003 Atypical expansion in mice of the sensory neuron-specific Mrg G protein-coupled receptor family.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11551509 2001 A diverse family of GPCRs expressed in specific subsets of nociceptive sensory neurons.