Property Summary

NCBI Gene PubMed Count 8
PubMed Score 42.44
PubTator Score 9.70

Knowledge Summary

Patent (2,077)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Meningitis 67 3.171 1.6

Expression

Gene RIF (3)

AA Sequence

MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAA      1 - 70
ADLLFLFSMASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRH     71 - 140
LSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQ    141 - 210
QWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVG    211 - 280
SRRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA                                 281 - 321
//

Text Mined References (8)

PMID Year Title