Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.51
PubTator Score 5.28

Knowledge Summary

Patent (1,548)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.070 0.000

Synonym

Accession Q8TDS5 Q86WP7 Q8NGW4
Symbols GPCR
GPR170
TG1019

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (6)

PMID Text
25657046 membrane receptor OxeR1 is involved in StAR protein induction and activation of steroidogenesis triggered by cAMP or angiotensin II, acting, at least in part, through ERK1/2 activation.
24733850 Gue1654 as a non-Galphai-biased antagonist of OXE-R that provides a new basis for therapeutic intervention in inflammatory diseases that involve activation of eosinophils, neutrophils, and monocytes.
23643940 OXER1 has a role in regulating the survival-promoting effects of arachidonate 5-lipoxygenase in prostate cancer cells
16289380 5-oxoER is critical for prostate cancer cell survival.
12606753 identification and cloning of a novel GPCR, R527; 5-oxo-ETE was identified as the ligand for R527; very high level of mRNA expression in eosinophils with high expression also detected in neutrophils and lung macrophages
12065583 Identification of a novel human receptor coupled to G(i/o).

AA Sequence

MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPSFSPSPSSAPS      1 - 70
AFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIHTRPWTSNTVFLVSLVAADFL     71 - 140
LISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASVVFLTAIALNRYLKVVQPHHVLSRASVGAAA    141 - 210
RVAGGLWVGILLLNGHLLLSTFSGPSCLSYRVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIR    211 - 280
NRGLGGQAGPQRAMRVLAMVVAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVL    281 - 350
DPVLYCFSSPNFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS    351 - 420
SQG                                                                       421 - 423
//

Text Mined References (15)

PMID Year Title
25657046 2015 OxeR1 regulates angiotensin II and cAMP-stimulated steroid production in human H295R adrenocortical cells.
24733850 2014 A biased non-G?i OXE-R antagonist demonstrates that G?i protein subunit is not directly involved in neutrophil, eosinophil, and monocyte activation by 5-oxo-ETE.
23643940 2013 OXER1, a G protein-coupled oxoeicosatetraenoid receptor, mediates the survival-promoting effects of arachidonate 5-lipoxygenase in prostate cancer cells.
18821565 2008 Genome-wide association scan of quantitative traits for attention deficit hyperactivity disorder identifies novel associations and confirms candidate gene associations.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
16289380 2006 Expression of 5-oxoETE receptor in prostate cancer cells: critical role in survival.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15001665 2004 International Union of Pharmacology XLIV. Nomenclature for the oxoeicosanoid receptor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...