Property Summary

Ligand Count 2
NCBI Gene PubMed Count 15
PubMed Score 5.76
PubTator Score 5.28

Knowledge Summary

Patent (1,548)

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.8e-04

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.070 1.8e-04

Gene RIF (6)

AA Sequence

MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPSFSPSPSSAPS      1 - 70
AFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIHTRPWTSNTVFLVSLVAADFL     71 - 140
LISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASVVFLTAIALNRYLKVVQPHHVLSRASVGAAA    141 - 210
RVAGGLWVGILLLNGHLLLSTFSGPSCLSYRVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIR    211 - 280
NRGLGGQAGPQRAMRVLAMVVAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVL    281 - 350
DPVLYCFSSPNFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS    351 - 420
SQG                                                                       421 - 423
//

Text Mined References (15)

PMID Year Title