Property Summary

Ligand Count 120
NCBI Gene PubMed Count 41
PubMed Score 125.99
PubTator Score 98.90

Knowledge Summary

Patent (18,477)

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.300 3.0e-02
lung carcinoma -1.700 3.1e-15

Gene RIF (33)

AA Sequence

MNRHHLQDHFLEIDKKNCCVFRDDFIVKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLA      1 - 70
VADFLLIICLPFLMDNYVRRWDWKFGDIPCRLMLFMLAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKIS     71 - 140
NRTAAIISCLLWGITIGLTVHLLKKKMPIQNGGANLCSSFSICHTFQWHEAMFLLEFFLPLGIILFCSAR    141 - 210
IIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIRIFWLLHTSGTQNCEVYRSVDLAFFITL    211 - 280
SFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSG    281 - 350
EPWSPSYLGPTSP                                                             351 - 363
//

Text Mined References (41)

PMID Year Title