Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.88
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (5)

AA Sequence

MLAGQLEARDPKEGTHPEDPCPGAGAVMEKTAVAAEVLTEDCNTGEMPPLQQQIIRLHQELGRQKSLWAD      1 - 70
VHGKLRSHIDALREQNMELREKLRALQLQRWKARKKSAASPHAGQESHTLALEPAFGKISPLSADEETIP     71 - 140
KYAGHKNQSATLLGQRSSSNNSAPPKPMSLKIERISSWKTPPQENRDKNLSRRRQDRRATPTGRPTPCAE    141 - 210
RRGGV                                                                     211 - 215
//

Text Mined References (15)

PMID Year Title