Property Summary

NCBI Gene PubMed Count 11
PubMed Score 4.90
PubTator Score 6.58

Knowledge Summary

Patent (787)

TINX Plot

  Disease Sources (2)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.902 0.000
medulloblastoma, large-cell -1.200 0.000
tuberculosis and treatment for 6 months 1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.002
spina bifida -1.214 0.042
ovarian cancer 2.200 0.000

Synonym

Accession Q8TDR2 B2RBM3 C7ENV8 Q2NKW6 Q5T3R1 Q5T3R2 Q96AB4 Q9BZ06
Symbols CLIK1
STK35L1

Gene

  Ortholog (8)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
21964068 constitutive overexpression of STK35 proteins enhances caspase-independent cell death under oxidative stress conditions.
21283756 by regulating CDKN2A and inhibiting G1- to S-phase transition STK35L1 may act as a central kinase linking the cell cycle and migration of endothelial cells
19756140 analysis of the STK35L proteins in human and in sea squirts
11973348 results establish the CLP-36 PDZ-LIM protein as an adapter, recruiting the Clik1 kinase to actin stress fibers in nonmuscle cells, and suggest that Clik1 represents a novel regulator of actin stress fibers

AA Sequence

MGHQESPLARAPAGGAAYVKRLCKGLSWREHVESHGSLGAQASPASAAAAEGSATRRARAATSRAARSRR      1 - 70
QPGPGADHPQAGAPGGKRAARKWRCAGQVTIQGPAPPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDG     71 - 140
ARRGTQSPERKRRSPVPRAPSTKLRPAAAARAMDPVAAEAPGEAFLARRRPEGGGGSARPRYSLLAEIGR    141 - 210
GSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSH    211 - 280
GNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAF    281 - 350
LHKNHIVHRDLKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDF    351 - 420
YMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHI    421 - 490
PQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQVTCAA                              491 - 534
//

Text Mined References (11)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
21964068 2012 Nuclear retention of importin ? coordinates cell fate through changes in gene expression.
21283756 2011 STK35L1 associates with nuclear actin and regulates cell cycle and migration of endothelial cells.
19756140 2009 Identifying and characterizing a novel protein kinase STK35L1 and deciphering its orthologs and close-homologs in vertebrates.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11973348 2002 Clik1: a novel kinase targeted to actin stress fibers by the CLP-36 PDZ-LIM protein.
More...