Property Summary

NCBI Gene PubMed Count 11
Grant Count 3
R01 Count 3
Funding $383,751
PubMed Score 4.90
PubTator Score 6.58

Knowledge Summary

Patent (787)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.902 0.000
medulloblastoma, large-cell -1.200 0.000
tuberculosis and treatment for 6 months 1.100 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.002
spina bifida -1.214 0.042
ovarian cancer 2.200 0.000

Synonym

Accession Q8TDR2 B2RBM3 C7ENV8 Q2NKW6 Q5T3R1 Q5T3R2 Q96AB4 Q9BZ06
Symbols CLIK1
STK35L1

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (4)

PMID Text
21964068 constitutive overexpression of STK35 proteins enhances caspase-independent cell death under oxidative stress conditions.
21283756 by regulating CDKN2A and inhibiting G1- to S-phase transition STK35L1 may act as a central kinase linking the cell cycle and migration of endothelial cells
19756140 analysis of the STK35L proteins in human and in sea squirts
11973348 results establish the CLP-36 PDZ-LIM protein as an adapter, recruiting the Clik1 kinase to actin stress fibers in nonmuscle cells, and suggest that Clik1 represents a novel regulator of actin stress fibers

AA Sequence

MGHQESPLARAPAGGAAYVKRLCKGLSWREHVESHGSLGAQASPASAAAAEGSATRRARAATSRAARSRR      1 - 70
QPGPGADHPQAGAPGGKRAARKWRCAGQVTIQGPAPPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDG     71 - 140
ARRGTQSPERKRRSPVPRAPSTKLRPAAAARAMDPVAAEAPGEAFLARRRPEGGGGSARPRYSLLAEIGR    141 - 210
GSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSH    211 - 280
GNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAF    281 - 350
LHKNHIVHRDLKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDF    351 - 420
YMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHI    421 - 490
PQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQVTCAA                              491 - 534
//

Text Mined References (11)

PMID Year Title
24811271 2014 Genome-wide SNP associations with rubella-specific cytokine responses in measles-mumps-rubella vaccine recipients.
21964068 2012 Nuclear retention of importin ? coordinates cell fate through changes in gene expression.
21283756 2011 STK35L1 associates with nuclear actin and regulates cell cycle and migration of endothelial cells.
19756140 2009 Identifying and characterizing a novel protein kinase STK35L1 and deciphering its orthologs and close-homologs in vertebrates.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11973348 2002 Clik1: a novel kinase targeted to actin stress fibers by the CLP-36 PDZ-LIM protein.
More...