Property Summary

Ligand Count 6
NCBI Gene PubMed Count 11
PubMed Score 5.03
PubTator Score 6.58

Knowledge Summary

Patent (787)

Expression

  Differential Expression (6)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.300 1.6e-03
medulloblastoma, large-cell -1.200 5.4e-05
osteosarcoma -1.821 1.9e-06
ovarian cancer 2.200 5.3e-05
spina bifida -1.214 4.2e-02
tuberculosis and treatment for 6 months 1.100 3.0e-04

Gene RIF (4)

AA Sequence

MGHQESPLARAPAGGAAYVKRLCKGLSWREHVESHGSLGAQASPASAAAAEGSATRRARAATSRAARSRR      1 - 70
QPGPGADHPQAGAPGGKRAARKWRCAGQVTIQGPAPPRPRAGRRDEAGGARAAPLLLPPPPAAMETGKDG     71 - 140
ARRGTQSPERKRRSPVPRAPSTKLRPAAAARAMDPVAAEAPGEAFLARRRPEGGGGSARPRYSLLAEIGR    141 - 210
GSYGVVYEAVAGRSGARVAVKKIRCDAPENVELALAEFWALTSLKRRHQNVVQFEECVLQRNGLAQRMSH    211 - 280
GNKSSQLYLRLVETSLKGERILGYAEEPCYLWFVMEFCEGGDLNQYVLSRRPDPATNKSFMLQLTSAIAF    281 - 350
LHKNHIVHRDLKPDNILITERSGTPILKVADFGLSKVCAGLAPRGKEGNQDNKNVNVNKYWLSSACGSDF    351 - 420
YMAPEVWEGHYTAKADIFALGIIIWAMIERITFIDSETKKELLGTYIKQGTEIVPVGEALLENPKMELHI    421 - 490
PQKRRTSMSEGIKQLLKDMLAANPQDRPDAFELETRMDQVTCAA                              491 - 534
//

Text Mined References (11)

PMID Year Title