Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.21
PubTator Score 8.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.200 0.007
osteosarcoma -1.154 0.015
ovarian cancer 1.100 0.011
chronic rhinosinusitis -1.340 0.009

Synonym

Accession Q8TDR0 Q6PCT1 Q7L8N9 Q9NRD6 Q9Y4Q1
Symbols IFT54
MIPT3
SLSN9
MIP-T3

Gene

PDB

2EQO  

Gene RIF (8)

PMID Text
26487268 Mutations in TRAF3IP1 are identified in patients with nephronophthisis and retinal degeneration. The identified mutations result in mild ciliary defects in patients and reveal a role of IFT54 as a negative regulator of microtubule stability via MAP4.
22079989 MIP-T3 functions as a negative regulator of the innate type I interferon response by preventing TRAF3 from forming protein complexes with critical downstream transducers and effectors of antiviral response.
21510943 Data show that MIP-T3 protein level is highly regulated; mainly mediated by the ubiquitin-proteasome system.
20391533 The interaction of MIP-T3 with both actin filaments and microtubule suggested that MIP-T3 may play an important role in regulation of cytoskeleton dynamics in cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19251251 Observational study of gene-disease association. (HuGE Navigator)
12935900 These results suggest that MIP-T3 is a novel inhibitor of IL-13 signaling and may be a useful molecule in ameliorating various conditions in which IL-13 plays a central role.

AA Sequence

MNAAVVRRTQEALGKVIRRPPLTEKLLSKPPFRYLHDIITEVIRMTGFMKGLYTDAEMKSDNVKDKDAKI      1 - 70
SFLQKAIDVVVMVSGEPLLAKPARIVAGHEPERTNELLQIIGKCCLNKLSSDDAVRRVLAGEKGEVKGRA     71 - 140
SLTSRSQELDNKNVREEESRVHKNTEDRGDAEIKERSTSRDRKQKEELKEDRKPREKDKDKEKAKENGGN    141 - 210
RHREGERERAKARARPDNERQKDRGNRERDRDSERKKETERKSEGGKEKERLRDRDRERDRDKGKDRDRR    211 - 280
RVKNGEHSWDLDREKNREHDKPEKKSASSGEMSKKLSDGTFKDSKAETETEISTRASKSLTTKTSKRRSK    281 - 350
NSVEGRKEDNISAKSLDSIVSGINNEPNQETTTSEIGTKEANINSTSISDDNSASLRCENIQPNPTEKQK    351 - 420
GDSTSDAEGDAGPAGQDKSEVPETPEIPNELSSNIRRIPRPGSARPAPPRVKRQDSMEALQMDRSGSGKT    421 - 490
VSNVITESHNSDNEEDDQFVVEAAPQLSEMSEIEMVTAVELEEEEKHGGLVKKILETKKDYEKLQQSPKP    491 - 560
GEKERSLFESAWKKEKDIVSKEIEKLRTSIQTLCKSALPLGKIMDYIQEDVDAMQNELQMWHSENRQHAE    561 - 630
ALQQEQRITDCAVEPLKAELAELEQLIKDQQDKICAVKANILKNEEKIQKMVYSINLTSRR             631 - 691
//

Text Mined References (19)

PMID Year Title
26487268 2015 Mutations in TRAF3IP1/IFT54 reveal a new role for IFT proteins in microtubule stabilization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22079989 2011 MIP-T3 is a negative regulator of innate type I IFN response.
21835309 2011 GWAS findings for human iris patterns: associations with variants in genes that influence normal neuronal pattern development.
21510943 2011 The C-terminus of MIP-T3 protein is required for ubiquitin-proteasome-mediated degradation in human cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20391533 2010 Proteomic analysis reveals novel binding partners of MIP-T3 in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19251251 2009 Association between genes of Disrupted in schizophrenia 1 (DISC1) interactors and schizophrenia supports the role of the DISC1 pathway in the etiology of major mental illnesses.
More...