Property Summary

NCBI Gene PubMed Count 50
PubMed Score 20.06
PubTator Score 24.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Body Weight 14 0.0 0.0
Disease Target Count P-value
lung carcinoma 2843 2.4e-09
ovarian cancer 8519 6.4e-09
primary pancreatic ductal adenocarcinoma 1108 8.1e-03
pancreatic cancer 2398 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
lung carcinoma 1.100 2.4e-09
ovarian cancer -1.600 6.4e-09
pancreatic cancer 1.100 1.2e-02
primary pancreatic ductal adenocarcinoma 1.050 8.1e-03

Gene RIF (19)

AA Sequence

MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN      1 - 70
MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP     71 - 140
DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAF    141 - 210
ALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN        211 - 276
//

Text Mined References (54)

PMID Year Title