Property Summary

NCBI Gene PubMed Count 49
Grant Count 1
Funding $152,943
PubMed Score 18.55
PubTator Score 24.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma 1.050 0.008
lung carcinoma 1.100 0.000
ovarian cancer -1.600 0.000
pancreatic cancer 1.100 0.012

Synonym

Accession Q8TDQ7 B4DJF3 Q2VYF1 Q59EA7 Q8NCZ8 Q96BJ4 Q96NC6
Symbols GNP2
SB52

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (18)

PMID Text
20843981 Observational study of gene-disease association. (HuGE Navigator)
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19910938 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGHLSFKYVKTFN      1 - 70
MDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDAFENKIKEAGGIDLFVGGIGP     71 - 140
DGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSKVPTMALTVGVGTVMDAREVMILITGAHKAF    141 - 210
ALYKAIEEGVNHMWTVSAFQQHPRTIFVCDEDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN        211 - 276
//

Text Mined References (53)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23583978 2013 A meta-analysis identifies new loci associated with body mass index in individuals of African ancestry.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22710927 2013 Genetic susceptibility, birth weight and obesity risk in young Chinese.
22511254 2012 Susceptibility variants for obesity and colorectal cancer risk: the multiethnic cohort and PAGE studies.
22456663 2012 Adult obesity susceptibility variants are associated with greater childhood weight gain and a faster tempo of growth: the 1946 British Birth Cohort Study.
22344219 2012 Meta-analysis identifies common variants associated with body mass index in east Asians.
More...