Property Summary

NCBI Gene PubMed Count 24
PubMed Score 36.48
PubTator Score 19.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Fibrinogen Adverse Event 20
Disease Target Count P-value
psoriasis 6685 2.2380886902033E-31
non-small cell lung cancer 2798 1.65994502348897E-20
lung carcinoma 2844 5.4402072256041E-16
osteosarcoma 7933 4.19924370229124E-6
tuberculosis 1563 2.25304804334328E-5
glioblastoma 5572 4.12778633527906E-5
atypical teratoid / rhabdoid tumor 4369 2.98891613418583E-4
adult high grade glioma 2148 3.96075709579673E-4
head and neck cancer and chronic obstructive pulmonary disease 237 4.16933531465309E-4
invasive ductal carcinoma 2950 0.0011644914847434
interstitial cystitis 2299 0.0027734636033073
ductal carcinoma in situ 1745 0.00443320023022655
Disease Target Count Z-score Confidence
Atherosclerosis 275 0.0 2.0

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -3.434 0.000
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
tuberculosis 2.000 0.000
non-small cell lung cancer -2.143 0.000
interstitial cystitis 1.700 0.003
adult high grade glioma 1.500 0.000
lung carcinoma -1.200 0.000
ductal carcinoma in situ 1.200 0.004
invasive ductal carcinoma 1.700 0.001
head and neck cancer and chronic obstruc... 1.200 0.000
psoriasis 1.800 0.000

Synonym

Accession Q8TDQ1 B2RCL2 C9JDN3 Q3Y6P0 Q6UX24 Q7Z6A6 Q7Z7I4 Q7Z7I5 Q8N6D0 Q8NAF5 CLM-1
Symbols CLM1
NKIR
CLM-1
IREM1
LMIR3
CD300f
IREM-1
IgSF13

Gene

PDB

2NMS  

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA EggNOG

Gene RIF (11)

PMID Text
25601189 findings suggest that two rare heterozygous truncating variations (RPS24 Q191X and CD300LF P261fsX266) are risk candidates for autism spectrum disorder.
23072861 CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo.
22288587 peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling
22043923 CD300f blocked the activation of cells induced by all TLR ligands
21951326 The data suggest that the neuroprotective role of CD300f would be the result of a complex network of cell interactions.
21536801 Data indicate that CD300F is an active regulator of TLR-mediated macrophage activation through association with SHP-1 involving MyD88 and/or TRIF.
20646006 Findings indicate that IREM-1 exerted its inhibitory effect on BAFF-medicated signalling through ITIM-mediated regulation of ERK activities in THP-1 cells.
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17202342 reveal a putative functional duality of the IREM-1 myeloid cell receptor
15549731 a novel inhibitory receptor of the Ig superfamily in myeloid cells. (IREM-1 = immune receptor expressed on myeloid cells-1)
More...

AA Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSG      1 - 70
SEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPT     71 - 140
LTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTL    141 - 210
QLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEE    211 - 280
PTEYSTISRP                                                                281 - 290
//

Text Mined References (26)

PMID Year Title
25601189 2015 Rare heterozygous truncating variations and risk of autism spectrum disorder: Whole-exome sequencing of a multiplex family and follow-up study in a Japanese population.
24035150 2014 Sphingomyelin and ceramide are physiological ligands for human LMIR3/CD300f, inhibiting Fc?RI-mediated mast cell activation.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23072861 2013 CD300 molecule regulation of human dendritic cell functions.
22288587 2012 Synthetic peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling through activation of SHP and/or PI3K.
22043923 2012 CD300a and CD300f differentially regulate the MyD88 and TRIF-mediated TLR signalling pathways through activation of SHP-1 and/or SHP-2 in human monocytic cell lines.
21951326 2012 Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury.
21536801 2011 CD300F blocks both MyD88 and TRIF-mediated TLR signaling through activation of Src homology region 2 domain-containing phosphatase 1.
20646006 2010 Immune receptor expressed on myeloid cells 1 (IREM-1) inhibits B cell activation factor (BAFF)-mediated inflammatory regulation of THP-1 cells through modulation of the activities of extracellular regulated kinase (ERK).
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
More...