Property Summary

NCBI Gene PubMed Count 24
Grant Count 28
R01 Count 13
Funding $4,121,430.89
PubMed Score 36.48
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma -3.434 0.000
glioblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
tuberculosis 2.000 0.000
non-small cell lung cancer -2.143 0.000
interstitial cystitis 1.700 0.003
adult high grade glioma 1.500 0.000
lung carcinoma -1.200 0.000
ductal carcinoma in situ 1.200 0.004
invasive ductal carcinoma 1.700 0.001
head and neck cancer and chronic obstruc... 1.200 0.000
psoriasis 1.800 0.000

Gene RIF (11)

PMID Text
25601189 findings suggest that two rare heterozygous truncating variations (RPS24 Q191X and CD300LF P261fsX266) are risk candidates for autism spectrum disorder.
23072861 CD300 molecules are all expressed by DC; CD300b, d, e and f are restricted to different subpopulations of the myeloid DC lineage. They have been shown to regulate DC function both in vitro and in vivo.
22288587 peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling
22043923 CD300f blocked the activation of cells induced by all TLR ligands
21951326 The data suggest that the neuroprotective role of CD300f would be the result of a complex network of cell interactions.
21536801 Data indicate that CD300F is an active regulator of TLR-mediated macrophage activation through association with SHP-1 involving MyD88 and/or TRIF.
20646006 Findings indicate that IREM-1 exerted its inhibitory effect on BAFF-medicated signalling through ITIM-mediated regulation of ERK activities in THP-1 cells.
20031577 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17202342 reveal a putative functional duality of the IREM-1 myeloid cell receptor
15549731 a novel inhibitory receptor of the Ig superfamily in myeloid cells. (IREM-1 = immune receptor expressed on myeloid cells-1)
More...

AA Sequence

MPLLTLYLLLFWLSGYSIVTQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSG      1 - 70
SEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPT     71 - 140
LTGHHLDNRHKLLKLSVLLPLIFTILLLLLVAASLLAWRMMKYQQKAAGMSPEQVLQPLEGDLCYADLTL    141 - 210
QLAGTSPQKATTKLSSAQVDQVEVEYVTMASLPKEDISYASLTLGAEDQEPTYCNMGHLSSHLPGRGPEE    211 - 280
PTEYSTISRP                                                                281 - 290
//

Text Mined References (26)

PMID Year Title
25601189 2015 Rare heterozygous truncating variations and risk of autism spectrum disorder: Whole-exome sequencing of a multiplex family and follow-up study in a Japanese population.
24035150 2014 Sphingomyelin and ceramide are physiological ligands for human LMIR3/CD300f, inhibiting Fc?RI-mediated mast cell activation.
23969696 2013 Multiethnic meta-analysis of genome-wide association studies in >100 000 subjects identifies 23 fibrinogen-associated Loci but no strong evidence of a causal association between circulating fibrinogen and cardiovascular disease.
23072861 2013 CD300 molecule regulation of human dendritic cell functions.
22288587 2012 Synthetic peptides containing ITIM-like sequences of IREM-1 (CD300F) differentially regulate MyD88 and TRIF-mediated TLR signalling through activation of SHP and/or PI3K.
22043923 2012 CD300a and CD300f differentially regulate the MyD88 and TRIF-mediated TLR signalling pathways through activation of SHP-1 and/or SHP-2 in human monocytic cell lines.
21951326 2012 Overexpression of the immunoreceptor CD300f has a neuroprotective role in a model of acute brain injury.
21536801 2011 CD300F blocks both MyD88 and TRIF-mediated TLR signaling through activation of Src homology region 2 domain-containing phosphatase 1.
20646006 2010 Immune receptor expressed on myeloid cells 1 (IREM-1) inhibits B cell activation factor (BAFF)-mediated inflammatory regulation of THP-1 cells through modulation of the activities of extracellular regulated kinase (ERK).
20031577 2009 Novel loci, including those related to Crohn disease, psoriasis, and inflammation, identified in a genome-wide association study of fibrinogen in 17 686 women: the Women's Genome Health Study.
More...