Property Summary

NCBI Gene PubMed Count 189
Grant Count 166
R01 Count 67
Funding $20,534,869.55
PubMed Score 410.35
PubTator Score 254.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TDQ0 B2RAY2 Q8WW60 Q96K94 HAVcr-2
Symbols TIM3
CD366
KIM-3
TIMD3
Tim-3
TIMD-3
HAVcr-2

Gene

PDB

5DZL   5F71  

 GO Function (1)

Gene RIF (185)

PMID Text
27049082 decreased serum TIM-1 and TIM-3 levels and association of TIM-3 with nephritis suggest their possible role in the development and pathogenesis of systemic lupus erythematosus.
26930930 Data show that T cell immunoglobulin and mucin domain protein 3 (Tim-3) on peripheral blood CD4+ T cells is increased in advanced schistosomiasis patients.
26492563 TIM-3 is a negative regulator of TCR-function by attenuating activation signals mediated by CD3/CD28 co-stimulation.
26464703 Tim-3 played an important role in the development and progression of gastric cancer, and it could be used as an independent prognostic factor for gastric cancer patients.
26463635 Diffuse large B-cell lymphoma patients have high expression level of PD-1 and TIM-3, which are related to DLBCL staging. PD-1 and TIM-3 expression levels are also related to the efficiency of chemotherapy.
26428847 These data indicate that Tim-3 expression in NK cells can function as a prognostic biomarker in human lung adenocarcinoma and support that Tim-3 could be a new target for an immunotherapeutic strategy.
26413815 Tim-3 in primary leukocytes, both healthy and malignant AML cells, displays moderate properties of an inflammatory receptor with additional growth factor (mTOR activation) and pro-angiogenic (VEGF release) activities
26401029 Studied the effects of altered Tim-3 expression in vivo in mice and in vitro in human endothelial cells, on day 3 after Rickettsia heilongjiangensis infection.
26373631 sTim-3 was involved in the development of sepsis. The homeostasis-promoting role of the Tim-3 on the monocytes was disrupted, while the inhibitory role of sTim-3 emerged during sepsis-induced immunosuppression.
26342682 an abnormal Tim-3/Gal-9 pathway was able to facilitate the development of preeclampsia.
More...

AA Sequence

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRT      1 - 70
DERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTR     71 - 140
QRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIGIYIGAGIC    141 - 210
AGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEY    211 - 280
YCYVSSRQQPSQPLGCRFAMP                                                     281 - 301
//

Text Mined References (192)

PMID Year Title
27049082 Decreased serum levels of T-cell immunoglobulin mucin-1 and T-cell immunoglobulin mucin-3 in systemic lupus erythematosus patients.
26930930 2015 [Expression of Tim-3 on peripheral blood CD4+ T cells and its correlation with liver function damage parameters in advanced schistosomiasis patients].
26492563 2015 TIM-3 Suppresses Anti-CD3/CD28-Induced TCR Activation and IL-2 Expression through the NFAT Signaling Pathway.
26464703 2015 Expression of Tim-3 in gastric cancer tissue and its relationship with prognosis.
26463635 2015 Prognostic value of PD-1 and TIM-3 on CD3+ T cells from diffuse large B-cell lymphoma.
26428847 2015 Increased Tim-3 expression in peripheral NK cells predicts a poorer prognosis and Tim-3 blockade improves NK cell-mediated cytotoxicity in human lung adenocarcinoma.
26413815 2015 Differential expression and biochemical activity of the immune receptor Tim-3 in healthy and malignant human myeloid cells.
26401029 2016 Enhanced Expression of T-Cell Immunoglobulin and Mucin Domain Protein 3 in Endothelial Cells Facilitates Intracellular Killing of Rickettsia heilongjiangensis.
26373631 2015 Plasma soluble Tim-3 emerges as an inhibitor in sepsis: sepsis contrary to membrane Tim-3 on monocytes.
26342682 2015 Upregulation of the Tim-3/Gal-9 pathway and correlation with the development of preeclampsia.
More...