Property Summary

NCBI Gene PubMed Count 234
PubMed Score 489.63
PubTator Score 254.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma 1.100 3.8e-02
Astrocytoma, Pilocytic 1.500 1.4e-07
glioblastoma 1.100 1.2e-02
group 3 medulloblastoma -1.200 1.3e-02
head and neck cancer and chronic obstruc... 1.300 2.2e-03
inflammatory breast cancer 1.300 4.7e-03
interstitial cystitis 1.100 2.6e-02
invasive ductal carcinoma 1.546 2.6e-05
lung carcinoma -2.200 4.7e-19
medulloblastoma, large-cell -1.200 2.8e-03
non-small cell lung cancer -1.013 7.3e-07
osteosarcoma 1.085 1.2e-02
ovarian cancer 1.700 1.9e-04
pulmonary arterial hypertension -2.200 3.5e-02
subependymal giant cell astrocytoma 1.647 1.2e-02
tuberculosis -1.500 2.2e-05

 GO Function (1)

Gene RIF (229)

AA Sequence

MFSHLPFDCVLLLLLLLLTRSSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRT      1 - 70
DERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTR     71 - 140
QRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIGIYIGAGIC    141 - 210
AGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGLANAVAEGIRSEENIYTIEENVYEVEEPNEY    211 - 280
YCYVSSRQQPSQPLGCRFAMP                                                     281 - 301
//

Text Mined References (237)

PMID Year Title