Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.37
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Atopic dermatitis 944 0.00135762939657871

Expression

  Differential Expression (1)

Disease log2 FC p
Atopic dermatitis -1.600 0.001

Synonym

Accession Q8TDN7 AlkCDase 1
Symbols ASAH3
ALKCDase1

Gene

PANTHER Protein Class (1)

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (2)

PMID Text
17713573 upregulation of haCER1 and AC mediates the Ca2+(o)-induced growth arrest and differentiation of keratinocytes by generating sphingosine and its phosphate
11915342 regulates the signaling system mediated by sphingolipids

AA Sequence

MPSIFAYQSSEVDWCESNFQYSELVAEFYNTFSNIPFFIFGPLMMLLMHPYAQKRSRYIYVVWVLFMIIG      1 - 70
LFSMYFHMTLSFLGQLLDEIAILWLLGSGYSIWMPRCYFPSFLGGNRSQFIRLVFITTVVSTLLSFLRPT     71 - 140
VNAYALNSIALHILYIVCQEYRKTSNKELRHLIEVSVVLWAVALTSWISDRLLCSFWQRIHFFYLHSIWH    141 - 210
VLISITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC                    211 - 264
//

Text Mined References (7)

PMID Year Title
20628055 2010 Alkaline ceramidase 2 (ACER2) and its product dihydrosphingosine mediate the cytotoxicity of N-(4-hydroxyphenyl)retinamide in tumor cells.
17713573 2008 Upregulation of the human alkaline ceramidase 1 and acid ceramidase mediates calcium-induced differentiation of epidermal keratinocytes.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
16477081 2006 Differentiation-associated expression of ceramidase isoforms in cultured keratinocytes and epidermis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12783875 2003 Cloning and characterization of a mouse endoplasmic reticulum alkaline ceramidase: an enzyme that preferentially regulates metabolism of very long chain ceramides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.