Property Summary

NCBI Gene PubMed Count 9
PubMed Score 53.76
PubTator Score 246.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.1e-04
colon cancer 1478 2.5e-04
medulloblastoma, large-cell 6241 2.8e-04
lung cancer 4740 5.8e-04

Expression

  Differential Expression (4)

Disease log2 FC p
colon cancer 1.300 2.5e-04
lung cancer 1.200 5.8e-04
medulloblastoma, large-cell 1.200 2.8e-04
ovarian cancer 1.300 1.1e-04

AA Sequence

MAATKRKRRGGFAVQAKKPKRNEIDAEPPAKRHATAEEVEEEERDRIPGPVCKGKWKNKERILIFSSRGI      1 - 70
NFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEAKKKQDLYMWLSNSPHGPSAK     71 - 140
FLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYALLKELLIQIFSTPRYHPKSQPFVDHVFTFTI    141 - 210
LDNRIWFRNFQIIEEDAALVEIGPRFVLNLIKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREK    211 - 280
QQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQRMDSG    281 - 350
KTK                                                                       351 - 353
//

Text Mined References (18)

PMID Year Title