Property Summary

NCBI Gene PubMed Count 42
PubMed Score 14.89
PubTator Score 18.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.900 3.4e-06
Astrocytoma, Pilocytic -1.700 6.6e-06
atypical teratoid / rhabdoid tumor -1.200 2.6e-04
ductal carcinoma in situ -1.200 3.1e-03
ependymoma -1.200 2.1e-02
glioblastoma -2.100 6.8e-10
group 3 medulloblastoma -1.700 1.1e-03
intraductal papillary-mucinous adenoma (... 1.600 4.1e-04
invasive ductal carcinoma -1.400 8.5e-03
medulloblastoma, large-cell -1.200 3.2e-03
non-small cell lung cancer -1.122 7.0e-17
osteosarcoma 1.287 5.9e-03
primitive neuroectodermal tumor -1.300 7.6e-03
progressive supranuclear palsy 1.500 5.6e-03
subependymal giant cell astrocytoma -1.494 5.7e-03
tuberculosis -1.100 9.9e-05

Protein-protein Interaction (2)

Gene RIF (12)

AA Sequence

MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPRRRQAALSFLT      1 - 70
NISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCIALAAPGTPAAGLAAGSGPCL     71 - 140
PQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQWQPPRPAPLAACAQLQLLDGSGAAGQEELEE    141 - 210
DDAFISVQVPAAAFLGSGTPGSGSGSRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQR    211 - 280
SRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSI    281 - 350
FSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTS    351 - 420
SFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVK    421 - 490
PSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRK    491 - 560
LCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLV    561 - 630
QSS                                                                       631 - 633
//

Text Mined References (48)

PMID Year Title