Property Summary

NCBI Gene PubMed Count 41
Grant Count 1
Funding $99,902
PubMed Score 14.07
PubTator Score 18.64

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26695862 CABLES1 is a critical regulator of corticotrope proliferation that defines a pathway often inactivated in Cushing disease
25361894 Results illuminated a dynamic regulatory system through which activated Akt and 14-3-3 work directly together to neutralize a potent tumor suppressor function of Cables1.
24975575 the results suggest Cables1 as a novel p21 regulator through maintaining p21 stability and support the model that the tumor-suppressive function of Cables1 occurs at least in part through enhancing the tumor-suppressive activity of p21.
23333304 HIV-1 Vif upregulates the expression of Cdk5 and Abl enzyme substrate 1 (CABLES1) in Vif-expression T cells
21890215 The results did not detect a significant association. It indicated that common genetic variations in CDK5 genes might not play a role in the genetic predisposition to autism.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
18059193 Mechanisms of CABLES1 gene inactivation in ovarian cancer development are reported.
17982127 Loss of Cables expression in 65% of CRCs suggests that it is a common event in colonic carcinogenesis, with promoter methylation and LOH appearing to be important mechanisms of Cables gene inactivation.
16177568 Analysis of the RT-PCR prducts of the CABLES1 gene showed eight intragenic deletions in its mRNA transcripts; 5/8 are the result of RNA splicing.

AA Sequence

MAAAAAAATTAACSSGSAGTDAAGASGLQQPPPQPQPQPAAAAPAQPPPEPPRKPRMDPRRRQAALSFLT      1 - 70
NISLDGRLPPQDAEWGGGEEGGAAKPGAGGACGARTRFSLLAAAERGGCIALAAPGTPAAGLAAGSGPCL     71 - 140
PQPSSLPPLIPGGHATVSGPGVARGFASPLGAGRASGEQWQPPRPAPLAACAQLQLLDGSGAAGQEELEE    141 - 210
DDAFISVQVPAAAFLGSGTPGSGSGSRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQR    211 - 280
SRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKNFKKIHFIKNMRQHDTRNGRIVLISGRRSFCSI    281 - 350
FSVLPYRDSTQVGDLKLDGGRQSTGAVSLKEIIGLEGVELGADGKTVSYTQFLLPTNAFGARRNTIDSTS    351 - 420
SFSQFRNLSHRSLSIGRASGTQGSLDTGSDLGDFMDYDPNLLDDPQWPCGKHKRVLIFPSYMTTVIDYVK    421 - 490
PSDLKKDMNETFKEKFPHIKLTLSKIRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRK    491 - 560
LCAGACVLLAAKIGSDLKKHEVKHLIDKLEEKFRLNRRELIAFEFPVLVALEFALHLPEHEVMPHYRRLV    561 - 630
QSS                                                                       631 - 633
//

Text Mined References (47)

PMID Year Title
26695862 2016 The Cables1 Gene in Glucocorticoid Regulation of Pituitary Corticotrope Growth and Cushing Disease.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25361894 2015 Cables1 complex couples survival signaling to the cell death machinery.
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24975575 2015 Cables1 controls p21/Cip1 protein stability by antagonizing proteasome subunit alpha type 3.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23505323 2013 Genomic study in Mexicans identifies a new locus for triglycerides and refines European lipid loci.
More...