Property Summary

Ligand Count 3
NCBI Gene PubMed Count 29
PubMed Score 25.47
PubTator Score 45.83

Knowledge Summary

Patent (1,207)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.600 8.8e-03

Gene RIF (20)

AA Sequence

MLKQSERRRSWSYRPWNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDD      1 - 70
LAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELAGFPKTRLGRLATSTSRSRQLSLCD     71 - 140
DYEEQTDEYFFDRDPAVFQLVYNFYLSGVLLVLDGLCPRRFLEELGYWGVRLKYTPRCCRICFEERRDEL    141 - 210
SERLKIQHELRAQAQVEEAEELFRDMRFYGPQRRRLWNLMEKPFSSVAAKAIGVASSTFVLVSVVALALN    211 - 280
TVEEMQQHSGQGEGGPDLRPILEHVEMLCMGFFTLEYLLRLASTPDLRRFARSALNLVDLVAILPLYLQL    281 - 350
LLECFTGEGHQRGQTVGSVGKVGQVLRVMRLMRIFRILKLARHSTGLRAFGFTLRQCYQQVGCLLLFIAM    351 - 420
GIFTFSAAVYSVEHDVPSTNFTTIPHSWWWAAVSISTVGYGDMYPETHLGRFFAFLCIAFGIILNGMPIS    421 - 490
ILYNKFSDYYSKLKAYEYTTIRRERGEVNFMQRARKKIAECLLGSNPQLTPRQEN                   491 - 545
//

Text Mined References (29)

PMID Year Title