Property Summary

Ligand Count 3
NCBI Gene PubMed Count 12
PubMed Score 6.96
PubTator Score 4.95

Knowledge Summary

Patent (693)

TINX Plot

Expression

Gene RIF (6)

AA Sequence

MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRY      1 - 70
LLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAFGVIVSFLAAGKLVLLQEMCA     71 - 140
LSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREM    141 - 210
VENPQSGLPGKVFACLSILFVATTAVSLCVSTMPDLRAEEDQGECSRKCYYIFIVETICVAWFSLEFCLR    211 - 280
FVQAQDKCQFFQGPLNIIDILAISPYYVSLAVSEEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRL    281 - 350
ARHSLGLQTLGLTVRRCTREFGLLLLFLAVAITLFSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVG    351 - 420
YGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQNTGPASECELL    421 - 490
DPHVASEHELMNDVNDLILEGPALPIMHM                                             491 - 519
//

Text Mined References (12)

PMID Year Title