Property Summary

NCBI Gene PubMed Count 65
Grant Count 1
Funding $41,785.71
PubMed Score 56.50
PubTator Score 70.28

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q8TDM6 A6H8Y3 Q149N1 Q5T1H7 Q5T1H8 Q6DKG3 Q86WC0 Q8TDM7 Q9UE73 Q9Y4E3
Symbols PDLG
LP-DLG
P-DLG5

Gene

PANTHER Protein Class (2)

 Grant Application (1)

PDB

1UIT  

Gene RIF (63)

PMID Text
25478998 These data suggest that inhibition of Dlg5 by DNA hypermethylation contributes to provoke invasive phenotypes in bladder tumor.
24910533 DLG5 plays a role in cell migration, cell adhesion, precursor cell division, cell proliferation, epithelial cell polarity maintenance, and transmission of extracellular signals to the membrane and cytoskeleton.
24662825 Findings demonstrate that Dlg5 interacts with and inhibits the activity of Girdin, thereby suppressing the migration of prostate cancer cells.
23624079 Overexpression of Dlg5 enhances the degradation of TGFBRI.
22118696 Polymorphisms in the DLG5 gene were found to be associated with Crohn's disease patients in Malaysia.
22065243 Examined the genetic association of DLG5 SNP P1371Q with inflammatory bowel disease and its interaction with R30Q in disease susceptibility. P1371Q is complementary to R30Q, with R30Q exhibiting a dominant effect in IBD susceptibility.
21674725 Increased expression of discs large homolog 5 gene is associated with ulcerative colitis.
20886065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20796250 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQD      1 - 70
LRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDQ     71 - 140
QVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHT    141 - 210
NALKRCEEVAKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIG    211 - 280
DLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLK    281 - 350
QTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEK    351 - 420
YREERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQIKDTVTMDAGR    421 - 490
ANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAE    491 - 560
ALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDI    561 - 630
DLKALGFDMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEG    631 - 700
AINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALD    701 - 770
NKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNN    771 - 840
STQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDV    841 - 910
RGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSIFDPNTFK    911 - 980
RPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSTSPPSA    981 - 1050
LPPDVDPGEPMHASPPRKARVRIASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFR   1051 - 1120
PKLAPVVIPAQFLEEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSS   1121 - 1190
ILRNPIYTVRSHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSAR   1191 - 1260
LGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQTSASTLPRIAV   1261 - 1330
NPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGI   1331 - 1400
NLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVIDPL   1401 - 1470
MEQDEGPSTPPAKQSSSRIAGDANKKTLEPRVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDG   1471 - 1540
LVPGDLILEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQ   1541 - 1610
ELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTL   1611 - 1680
SAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLD   1681 - 1750
VVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDI   1751 - 1820
APHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQG   1821 - 1890
GALSSICTQILAMVNQEQNKVLWIPACPL                                            1891 - 1919
//

Text Mined References (70)

PMID Year Title
25478998 2015 Methylation-mediated silencing of Dlg5 facilitates bladder cancer metastasis.
24910533 2014 DLG5 in cell polarity maintenance and cancer development.
24662825 2015 Loss of Dlg5 expression promotes the migration and invasion of prostate cancer cells via Girdin phosphorylation.
23624079 2013 Dlg5 interacts with the TGF-? receptor and promotes its degradation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22118696 2011 Identification of DLG5 and SLC22A5 gene polymorphisms in Malaysian patients with Crohn's disease.
22065243 2011 DLG5 P1371Q is associated with inflammatory bowel disease and complementary to R30Q in disease susceptibility.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21674725 2011 Increased expression of discs large homolog 5 gene (DLG5) in ulcerative colitis patients compared to healthy individuals.
More...