Property Summary

NCBI Gene PubMed Count 71
PubMed Score 56.21
PubTator Score 70.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.130 2.5e-07
Amyotrophic lateral sclerosis 1.099 5.2e-09
astrocytic glioma 1.500 1.4e-02
breast carcinoma 1.200 1.6e-02
cutaneous lupus erythematosus -1.200 6.6e-03
dermatomyositis 1.600 4.0e-04
group 3 medulloblastoma 1.300 8.1e-04
interstitial cystitis -1.200 7.3e-04
intraductal papillary-mucinous adenoma (... 1.200 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
lung cancer 1.400 3.4e-04
non-small cell lung cancer 1.502 8.1e-21
oligodendroglioma 1.800 1.2e-02
osteosarcoma 1.661 1.1e-06
ovarian cancer -1.900 3.0e-05
pancreatic ductal adenocarcinoma liver m... 2.197 3.3e-02
pituitary cancer -1.400 3.8e-05
spina bifida -1.442 4.6e-02
tuberculosis -1.200 1.3e-04

Gene RIF (68)

AA Sequence

MEPQRRELLAQCQQSLAQAMTEVEAVLGLLEAAGALSPGERRQLDEEAGGAKAELLLKLLLAKERDHFQD      1 - 70
LRAALEKTQPHLLPILYLNGVVGPPQPAEGAGSTYSVLSTMPSDSESSSSLSSVGTTGKAPSPPPLLTDQ     71 - 140
QVNEKVENLSIQLRLMTRERNELRKRLAFATHGTAFDKRPYHRLNPDYERLKIQCVRAMSDLQSLQNQHT    141 - 210
NALKRCEEVAKETDFYHTLHSRLLSDQTRLKDDVDMLRRENGQLLRERNLLQQSWEDMKRLHEEDQKEIG    211 - 280
DLRAQQQQVLKHNGSSEILNKLYDTAMDKLEVVKKDYDALRKRYSEKVAIHNADLSRLEQLGEENQRLLK    281 - 350
QTEMLTQQRDTAIQLQHQCALSLRRFEAIHHELNKATAQNKDLQWEMELLQSELTELRTTQVKTAKESEK    351 - 420
YREERDAVYSEYKLIMSERDQVISELDKLQTEVELAESKLKSSTSEKKAANEEMEALRQIKDTVTMDAGR    421 - 490
ANKEVEILRKQCKALCQELKEALQEADVAKCRRDWAFQERDKIVAERDSIRTLCDNLRRERDRAVSELAE    491 - 560
ALRSLDDTRKQKNDVSRELKELKEQMESQLEKEARFRQLMAHSSHDSAIDTDSMEWETEVVEFERETEDI    561 - 630
DLKALGFDMAEGVNEPCFPGDCGIFVTKVDKGSIADGRLRVNDWLLRINDVDLINKDKKQAIKALLNGEG    631 - 700
AINMVVRRRKSLGGKVVTPLHINLSGQKDSGISLENGVYAAAVLPGSPAAKEGSLAVGDRIVAINGIALD    701 - 770
NKSLNECESLLRSCQDSLTLSLLKVFPQSSSWSGQNIFENIKDSDKMLSFRAHGPEVQAHNKRNLIQHNN    771 - 840
STQTDIFYTDRLEDRKEPGPPGGSSSFLHKPFPGGPLQVCPQACPSASERSLSSFRSDASGDRGFGLVDV    841 - 910
RGRRPLLPFETEVGPCGVGEASLDKADSEGSNSGGTWPKAMLSSTAVPEKLSVYKKPKQRKSIFDPNTFK    911 - 980
RPQTPPKIDYLLPGPGPAHSPQPSKRAGPLTPPKPPRRSDSIKFQHRLETSSESEATLVGSSPSTSPPSA    981 - 1050
LPPDVDPGEPMHASPPRKARVRIASSYYPEGDGDSSHLPAKKSCDEDLTSQKVDELGQKRRRPKSAPSFR   1051 - 1120
PKLAPVVIPAQFLEEQKCVPASGELSPELQEWAPYSPGHSSRHSNPPLYPSRPSVGTVPRSLTPSTTVSS   1121 - 1190
ILRNPIYTVRSHRVGPCSSPPAARDAGPQGLHPSVQHQGRLSLDLSHRTCSDYSEMRATHGSNSLPSSAR   1191 - 1260
LGSSSNLQFKAERIKIPSTPRYPRSVVGSERGSVSHSECSTPPQSPLNIDTLSSCSQSQTSASTLPRIAV   1261 - 1330
NPASLGERRKDRPYVEEPRHVKVQKGSEPLGISIVSGEKGGIYVSKVTVGSIAHQAGLEYGDQLLEFNGI   1331 - 1400
NLRSATEQQARLIIGQQCDTITILAQYNPHVHQLSSHSRSSSHLDPAGTHSTLQGSGTTTPEHPSVIDPL   1401 - 1470
MEQDEGPSTPPAKQSSSRIAGDANKKTLEPRVVFIKKSQLELGVHLCGGNLHGVFVAEVEDDSPAKGPDG   1471 - 1540
LVPGDLILEYGSLDVRNKTVEEVYVEMLKPRDGVRLKVQYRPEEFTKAKGLPGDSFYIRALYDRLADVEQ   1541 - 1610
ELSFKKDDILYVDDTLPQGTFGSWMAWQLDENAQKIQRGQIPSKYVMDQEFSRRLSMSEVKDDNSATKTL   1611 - 1680
SAAARRSFFRRKHKHKRSGSKDGKDLLALDAFSSDSIPLFEDSVSLAYQRVQKVDCTALRPVLILGPLLD   1681 - 1750
VVKEMLVNEAPGKFCRCPLEVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIKEITEKNRHCLLDI   1751 - 1820
APHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQG   1821 - 1890
GALSSICTQILAMVNQEQNKVLWIPACPL                                            1891 - 1919
//

Text Mined References (76)

PMID Year Title