Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.44
PubTator Score 1.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Azoospermia 110 3.663 1.8

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATS      1 - 70
CGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLL                     71 - 124
//

Text Mined References (5)

PMID Year Title