Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.23
PubTator Score 1.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Azoospermia 89 3.657 1.8

Expression

Synonym

Accession Q8TDM5
Symbols SAMP14

Gene

Gene RIF (1)

PMID Text
12788941 SAMP14 represents a GPI-anchored putative receptor in the Ly-6/uPAR family that is exposed on the inner acrosomal membrane after the acrosome reaction.

AA Sequence

MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPVINKGCLRATS      1 - 70
CGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLPPRLL                     71 - 124
//

Text Mined References (5)

PMID Year Title
27098205 2016 Organization, evolution and functions of the human and mouse Ly6/uPAR family genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12788941 2003 SAMP14, a novel, acrosomal membrane-associated, glycosylphosphatidylinositol-anchored member of the Ly-6/urokinase-type plasminogen activator receptor superfamily with a role in sperm-egg interaction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.