Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.00
PubTator Score 4.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 3.7e-03
astrocytic glioma -2.800 2.8e-03
Astrocytoma, Pilocytic -1.600 6.2e-05
ependymoma -2.600 9.3e-03
glioblastoma -1.600 1.2e-04
group 4 medulloblastoma -1.700 1.7e-03
invasive ductal carcinoma 1.400 1.8e-02
malignant mesothelioma -1.200 3.9e-05
medulloblastoma, large-cell -2.700 9.2e-04
oligodendroglioma -2.500 6.7e-03
osteosarcoma 1.209 5.9e-04
primitive neuroectodermal tumor -1.600 1.5e-02

Gene RIF (1)

AA Sequence

MQRTGGGAPRPGRNHGLPGSLRQPDPVALLMLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEG      1 - 70
MLLRLEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAFVKMVGHHVAFLEADVLQAER     71 - 140
DHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPGSSDSPASASQVAGITEVTCTGARDVRAAHT    141 - 210
V//

Text Mined References (7)

PMID Year Title