Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.98
PubTator Score 4.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
astrocytic glioma -2.800 0.003
ependymoma -2.600 0.009
oligodendroglioma -2.500 0.007
glioblastoma -2.200 0.000
osteosarcoma -1.916 0.002
medulloblastoma -2.300 0.000
medulloblastoma, large-cell -2.700 0.001
primitive neuroectodermal tumor -1.600 0.015
adult high grade glioma -2.000 0.001
pilocytic astrocytoma -1.600 0.000
invasive ductal carcinoma 1.400 0.018

Gene RIF (1)

PMID Text
12378525 BCAS3 (17q23) and BCAS4 (20q13) undergo amplification, overexpression, and fusion in breast cancer.

AA Sequence

MQRTGGGAPRPGRNHGLPGSLRQPDPVALLMLLVDADQPEPMRSGARELALFLTPEPGAEAKEVEETIEG      1 - 70
MLLRLEEFCSLADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVDRLEAFVKMVGHHVAFLEADVLQAER     71 - 140
DHGAFPQALRRWLGSAGLPSFRNVECSGTIPARCNLRLPGSSDSPASASQVAGITEVTCTGARDVRAAHT    141 - 210
V//

Text Mined References (7)

PMID Year Title
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12378525 2002 Cloning of BCAS3 (17q23) and BCAS4 (20q13) genes that undergo amplification, overexpression, and fusion in breast cancer.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.