Property Summary

NCBI Gene PubMed Count 20
PubMed Score 17.41
PubTator Score 16.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 3.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Melanoma 711 0.0 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -2.500 3.2e-04

Gene RIF (10)

AA Sequence

MAGPWTFTLLCGLLAATLIQATLSPTAVLILGPKVIKEKLTQELKDHNATSILQQLPLLSAMREKPAGGI      1 - 70
PVLGSLVNTVLKHIIWLKVITANILQLQVKPSANDQELLVKIPLDMVAGFNTPLVKTIVEFHMTTEAQAT     71 - 140
IRMDTSASGPTRLVLSDCATSHGSLRIQLLHKLSFLVNALAKQVMNLLVPSLPNLVKNQLCPVIEASFNG    141 - 210
MYADLLQLVKVPISLSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPF    211 - 280
SLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLINEKAADKLGSTQIVKILTQDTPEFFI    281 - 350
DQGHAKVAQLIVLEVFPSSEALRPLFTLGIEASSEAQFYTKGDQLILNLNNISSDRIQLMNSGIGWFQPD    351 - 420
VLKNIITEIIHSILLPNQNGKLRSGVPVSLVKALGFEAAESSLTKDALVLTPASLWKPSSPVSQ          421 - 484
//

Text Mined References (20)

PMID Year Title