Property Summary

NCBI Gene PubMed Count 19
Grant Count 17
R01 Count 9
Funding $2,151,522.15
PubMed Score 12.59
PubTator Score 8.42

Knowledge Summary

Patent (832)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.567 0.000

Gene RIF (1)

PMID Text
18259073 Autozygosity by descent analysis of 2 markers bordering the TMC2 gene allowed us to rule out its association with deafness within these families.

AA Sequence

MSHQVKGLKEEARGGVKGRVKSGSPHTGDRLGRRSSSKRALKAEGTPGRRGAQRSQKERAGGSPSPGSPR      1 - 70
RKQTGRRRHREELGEQERGEAERTCEGRRKRDERASFQERTAAPKREKEIPRREEKSKRQKKPRSSSLAS     71 - 140
SASGGESLSEEELAQILEQVEEKKKLIATMRSKPWPMAKKLTELREAQEFVEKYEGALGKGKGKQLYAYK    141 - 210
MLMAKKWVKFKRDFDNFKTQCIPWEMKIKDIESHFGSSVASYFIFLRWMYGVNLVLFGLIFGLVIIPEVL    211 - 280
MGMPYGSIPRKTVPRAEEEKAMDFSVLWDFEGYIKYSALFYGYYNNQRTIGWLRYRLPMAYFMVGVSVFG    281 - 350
YSLIIVIRSMASNTQGSTGEGESDNFTFSFKMFTSWDYLIGNSETADNKYASITTSFKESIVDEQESNKE    351 - 420
ENIHLTRFLRVLANFLIICCLCGSGYLIYFVVKRSQQFSKMQNVSWYERNEVEIVMSLLGMFCPPLFETI    421 - 490
AALENYHPRTGLKWQLGRIFALFLGNLYTFLLALMDDVHLKLANEETIKNITHWTLFNYYNSSGWNESVP    491 - 560
RPPLHPADVPRGSCWETAVGIEFMRLTVSDMLVTYITILLGDFLRACFVRFMNYCWCWDLEAGFPSYAEF    561 - 630
DISGNVLGLIFNQGMIWMGSFYAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKASRSNNFYMGLLL    631 - 700
LVLFLSLLPVAYTIMSLPPSFDCGPFSGKNRMYDVLQETIENDFPTFLGKIFAFLANPGLIIPAILLMFL    701 - 770
AIYYLNSVSKSLSRANAQLRKKIQVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPS    771 - 840
ASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH        841 - 906
//

Text Mined References (19)

PMID Year Title
25114259 2014 Tip-link protein protocadherin 15 interacts with transmembrane channel-like proteins TMC1 and TMC2.
25074487 2015 Transmembrane channel-like (TMC) genes are required for auditory and vestibular mechanosensation.
24981230 2014 Conductance and block of hair-cell mechanotransducer channels in transmembrane channel-like protein mutants.
24423408 2014 TMC function in hair cell transduction.
24127526 2013 The role of transmembrane channel-like proteins in the operation of hair cell mechanotransducer channels.
23871232 2013 TMC1 and TMC2 are components of the mechanotransduction channel in hair cells of the mammalian inner ear.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22105165 2011 Perception of sound and gravity by TMC1 and TMC2.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
18259073 2008 TMC1 but not TMC2 is responsible for autosomal recessive nonsyndromic hearing impairment in Tunisian families.
More...