Property Summary

NCBI Gene PubMed Count 38
Grant Count 31
R01 Count 17
Funding $6,029,584.86
PubMed Score 17.78
PubTator Score 51.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.100 0.000
posterior fossa group A ependymoma -3.300 0.000
oligodendroglioma -2.100 0.000
glioblastoma -3.400 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.300 0.000
medulloblastoma, large-cell -3.500 0.000
primitive neuroectodermal tumor -1.900 0.014
adult high grade glioma -3.300 0.000
pilocytic astrocytoma -3.200 0.000
lung carcinoma 1.700 0.000
psoriasis -1.500 0.000

Gene RIF (29)

PMID Text
26753653 CHD5 methylation of rectal cancer has a great effect in influencing its clinical and pathological features.
26517514 Data show a mutual suppression regulation between chromodomain helicase DNA binding protein 5 (CHD5) and enhancer of zeste homolog 2 (EZH2, which may provide new insights into their potential therapeutic significance for hepatocellular carcinoma (HCC).
25247294 Study shows that CHD5 is a Nucleosome remodeling and deacetylase complex-associated transcriptional repressor and identifies WEE1 as one of the CHD5-regulated genes that may link CHD5 to tumor suppression.
24923445 The tumor suppressor chromodomain helicase DNA-binding protein 5 (CHD5) remodels nucleosomes by unwrapping.
24529164 CHD5 is a potential tumour suppressor gene epigenetically silenced in hepatocellular carcinoma.
24454811 repression of CHD5 gene expression in human leukemia is mediated in part by DNA methylation of its promoter.
24276239 Low CHD5 expression activates the DNA damage response and predicts poor outcome in patients undergoing adjuvant therapy for resected pancreatic cancer.
24243398 CHD5 activity is regulated by DNA methylation and repressive histone modifications. CHD5 likely acts as a tumor-suppressor gene in early colorectal carcinogenesis.
23948251 These findings provide insights into the regulatory role of CHD5 during neurogenesis and suggest how inactivation of this candidate tumor suppressor might contribute to neuroblastoma.
23707602 CHD5 might act as a tumor suppressor in glioma
More...

AA Sequence

MRGPVGTEEELPRLFAEEMENEDEMSEEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENKCKGKRKKKEG      1 - 70
SNDELSENEEDLEEKSESEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDEDDNDDGCLKEPKSSGQLMAE     71 - 140
WGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPFKGSSAAAAA    141 - 210
AAVAAAVETVTISPPLAVSPPQVPQPVPIRKAKTKEGKGPGVRKKIKGSKDGKKKGKGKKTAGLKFRFGG    211 - 280
ISNKRKKGSSSEEDEREESDFDSASIHSASVRSECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQ    281 - 350
QGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCR    351 - 420
VCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPG    421 - 490
PDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGD    491 - 560
EDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDDID    561 - 630
IPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTL    631 - 700
HPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEM    701 - 770
WAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIE    771 - 840
WACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFAD    841 - 910
ISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQV    911 - 980
SLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMT    981 - 1050
KMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDS   1051 - 1120
DWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELD   1121 - 1190
DILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDA   1191 - 1260
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQ   1261 - 1330
QQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQL   1331 - 1400
KSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSL   1401 - 1470
FMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPEGPEGKKSG   1471 - 1540
EVISSDPNTPVPASPAHLLPAPLGLPDKMEAQLGYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHES   1541 - 1610
PASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSRGDSSELRPDDTKAEEKEPIET   1611 - 1680
QQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVT   1681 - 1750
HGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNH   1751 - 1820
PAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAA   1821 - 1890
RLQMSERSILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI         1891 - 1954
//

Text Mined References (40)

PMID Year Title
26753653 Influence of colorectal cancer tumor suppressor gene CHD5 methylation on its clinical and pathological characteristics.
26517514 2015 Mutual regulation between CHD5 and EZH2 in hepatocellular carcinoma.
25247294 2014 The chromatin remodeling factor CHD5 is a transcriptional repressor of WEE1.
24923445 2014 The tumor suppressor chromodomain helicase DNA-binding protein 5 (CHD5) remodels nucleosomes by unwrapping.
24529164 2014 CHD5 a tumour suppressor is epigenetically silenced in hepatocellular carcinoma.
24454811 2014 Silencing of CHD5 gene by promoter methylation in leukemia.
24276239 2014 Low CHD5 expression activates the DNA damage response and predicts poor outcome in patients undergoing adjuvant therapy for resected pancreatic cancer.
24243398 2014 Epigenetic silencing of CHD5, a novel tumor-suppressor gene, occurs in early colorectal cancer stages.
23948251 2013 CHD5 is required for neurogenesis and has a dual role in facilitating gene expression and polycomb gene repression.
23707602 2013 Downregulation of chromatin remodeling factor CHD5 is associated with a poor prognosis in human glioma.
More...