Property Summary

NCBI Gene PubMed Count 5
Grant Count 93
R01 Count 63
Funding $7,992,230.48
PubMed Score 0.83
PubTator Score 14.07

Knowledge Summary

Patent

No data available

Synonym

Accession Q8TDG2 Q6X7C1 Q96L10 ARP-T1
Symbols AIP1
ARIP1
ARPT1
HSD27

Gene

Gene RIF (1)

PMID Text
12243744 Describes the discovery of two actin-related proteins as major components in a cytoskeletal, nonmotile structure of bull spermatozoa, suggesting that certain members of this family of proteins may serve functions other than nucleation of actin filaments.

AA Sequence

MFNPHALDVPAVIFDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPLARLNQKYFVGQEALYKYEALHL      1 - 70
HYPIERGLVTGWDDMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREIREKLAEMMFETFSVPGFYLSNH     71 - 140
AVAALYASACVTGLVVDSGDGVTCTVPIFEGYSLPHAVTKLCMAGRDITEHLTRLLFASGFNFPCILNKA    141 - 210
VVNNIKEKLCYIALEPEKELRKSRGEVLGAYRLPDGHVIHFGDELYQVPEVLFAPDQLGIHSPGLSKMVS    211 - 280
SSIMKCDTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDRCFSAWIGASIMTSM    281 - 350
SSFKQMWVTSADFKEYGTSVVQRRCF                                                351 - 376
//

Text Mined References (5)

PMID Year Title
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12243744 2002 Novel actin-related proteins Arp-T1 and Arp-T2 as components of the cytoskeletal calyx of the mammalian sperm head.