Property Summary

NCBI Gene PubMed Count 5
Grant Count 6
R01 Count 4
Funding $141,698.19
PubMed Score 9.01
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Gene RIF (3)

PMID Text
22272736 Only two single-nucleotide polymorphisms and four unique alleles were identified within the RNase 8 coding sequence.
17116644 Study shows that both the loss and gain of the cysteines in human RNase 8 occurred in the common ancestor of African great apes (humans, chimps, and gorillas) 7-13 MYA.
16940129 RNase 8 was identified as a human antimicrobial protein with a broad spectrum activity against pathogenic organisms.

AA Sequence

MAPARAGCCPLLLLLLGLWVAEVLVRAKPKDMTSSQWFKTQHVQPSPQACNSAMSIINKYTERCKDLNTF      1 - 70
LHEPFSSVAITCQTPNIACKNSCKNCHQSHGPMSLTMGELTSGKYPNCRYKEKHLNTPYIVACDPPQQGD     71 - 140
PGYPLVPVHLDKVV                                                            141 - 154
//

Text Mined References (6)

PMID Year Title
22272736 2012 Genetic diversity of human RNase 8.
17116644 2007 Disulfide-bond reshuffling in the evolution of an ape placental ribonuclease.
16940129 2006 Identification of RNase 8 as a novel human antimicrobial protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11861908 2002 RNase 8, a novel RNase A superfamily ribonuclease expressed uniquely in placenta.