Property Summary

NCBI Gene PubMed Count 5
PubMed Score 9.01
PubTator Score 6.33

Knowledge Summary

Patent

No data available

Gene RIF (3)

AA Sequence

MAPARAGCCPLLLLLLGLWVAEVLVRAKPKDMTSSQWFKTQHVQPSPQACNSAMSIINKYTERCKDLNTF      1 - 70
LHEPFSSVAITCQTPNIACKNSCKNCHQSHGPMSLTMGELTSGKYPNCRYKEKHLNTPYIVACDPPQQGD     71 - 140
PGYPLVPVHLDKVV                                                            141 - 154
//

Text Mined References (6)

PMID Year Title