Property Summary

NCBI Gene PubMed Count 51
Grant Count 255
R01 Count 157
Funding $35,021,494.58
PubMed Score 553.55
PubTator Score 217.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.300 0.002

Synonym

Accession Q8TDD2 B3KY26 Q3MJ72 Q7Z718
Symbols OSX
OI11
OI12
osterix

Gene

SP7

Gene RIF (45)

PMID Text
26496941 Data suggest that beta-catenin (beta-cat) signaling upregulates the expression of osterix (OSX) in pre-osteoblastic and bone marrow stromal cells.
26413977 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25802190 c-Src signaling modulates osteoblast differentiation at least in part through phosphorylation of Osterix.
25463757 Pin1 regulates the osteogenic activity of Osterix.
25258338 Osx might function as a potential regulator for the proliferation and odontoblastic differentiation of hDPCs.
25158187 Runx2-Sp7 molecular complex functionally cooperate for maximal induction of cell-phenotype-restricted genes
25122769 results provide a molecular description of a mechanism for Osx and Runx2 transcriptional cooperation that is subject to further regulation by MAPK-activating signals during osteogenesis.
25025858 The 2 genes RUNX1 and SP7 resulted differently expressed in cells cultured on metallic supports if compared with the expression recorded for OIC
24905700 Osterix is a novel target of protein kinase A, and protein kinase A modulates osteoblast differentiation partially through the regulation of Osterix.
24387671 In adamantinomatous craniopharyngioma, Bmp2 was expressed primarily in the stellate reticulum and whorl-like array cells; Runx2 and Osterix tended to be expressed in calcification-related epithelia.
More...

AA Sequence

MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSVGSDLSASKTMGDAYPAPFTS      1 - 70
TNGLLSPAGSPPAPTSGYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYK     71 - 140
AGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLPTGPAQPPLNPQLPTYPSDFAPLNPAPY    141 - 210
PAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGGAKPPRGASTGGSGGYGGSGAGRSSCDCPNCQELER    211 - 280
LGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTR    281 - 350
EKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSTGEEEASQTPRPSASPATPEKAPG    351 - 420
GSPEQSNLLEI                                                               421 - 431
//

Text Mined References (53)

PMID Year Title
26496941 2015 ?-catenin signaling induces the osteoblastogenic differentiation of human pre-osteoblastic and bone marrow stromal cells mainly through the upregulation of osterix expression.
26413977 2016 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25802190 2015 Src enhances osteogenic differentiation through phosphorylation of Osterix.
25463757 2015 Prolyl isomerase Pin1 regulates the osteogenic activity of Osterix.
25258338 2014 The effects of osterix on the proliferation and odontoblastic differentiation of human dental papilla cells.
25158187 2014 Sp7 and Runx2 molecular complex synergistically regulate expression of target genes.
25122769 2014 Mitogen-activated protein kinase (MAPK)-regulated interactions between Osterix and Runx2 are critical for the transcriptional osteogenic program.
25025858 2014 Expression of SP7, RUNX1, DLX5, and CTNNB1 in human mesenchymal stem cells cultured on xenogeneic bone substitute as compared with machined titanium.
24905700 2014 Protein kinase A regulates the osteogenic activity of Osterix.
24387671 2014 Does the calcification of adamantinomatous craniopharyngioma resemble the calcium deposition of osteogenesis/odontogenesis?
More...