Property Summary

Ligand Count 4
NCBI Gene PubMed Count 16
PubMed Score 28.86
PubTator Score 31.25

Knowledge Summary

Patent (10,643)

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 1.5e-13
glioblastoma 5792 2.8e-07
pediatric high grade glioma 1064 1.3e-05
group 3 medulloblastoma 4104 8.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Rabies 20 3.652 1.8
Premature ovarian failure 65 3.053 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.900 1.5e-13
glioblastoma -1.300 2.8e-07
group 3 medulloblastoma -1.100 8.7e-03
pediatric high grade glioma -1.200 1.3e-05

Gene RIF (9)

AA Sequence

MSSGAKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKVAIKIVNREKL      1 - 70
SESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQI     71 - 140
VSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIKGEKYDGR    141 - 210
RADMWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQ    211 - 280
KHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMI    281 - 350
YYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRA    351 - 420
LEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGGGAGE    421 - 490
QPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSF    491 - 560
LGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS    561 - 630
IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSR    631 - 700
RFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRGPPKDKKLL    701 - 770
ATNGTPLP                                                                  771 - 778
//

Text Mined References (22)

PMID Year Title