Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 9
Funding $558,294.27
PubMed Score 27.41
PubTator Score 31.25

Knowledge Summary

Patent (10,643)

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma -2.100 0.000
glioblastoma -1.300 0.000
pediatric high grade glioma -1.200 0.000
group 3 medulloblastoma -1.100 0.009

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

PMID Text
25036402 BRSK1 is a novel tumor suppressor in breast cancer which inversely correlated with Jab1 expression.
22131368 Single nucleotide polymorphism in BRSK1 is associated with the length of reproductive lifespan.
19648910 SADB kinase activity controls centrosome homeostasis by regulating phosphorylation of gamma-tubulin.
19448621 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19448619 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18339622 protein phosphatase 2C is a likely candidate for catalyzing the dephosphorylation and inactivation of BRSK1/2.
15150265 acts as checkpoint kinase upon DNA damage induced by UV

AA Sequence

MSSGAKEGGGGSPAYHLPHPHPHPPQHAQYVGPYRLEKTLGKGQTGLVKLGVHCITGQKVAIKIVNREKL      1 - 70
SESVLMKVEREIAILKLIEHPHVLKLHDVYENKKYLYLVLEHVSGGELFDYLVKKGRLTPKEARKFFRQI     71 - 140
VSALDFCHSYSICHRDLKPENLLLDEKNNIRIADFGMASLQVGDSLLETSCGSPHYACPEVIKGEKYDGR    141 - 210
RADMWSCGVILFALLVGALPFDDDNLRQLLEKVKRGVFHMPHFIPPDCQSLLRGMIEVEPEKRLSLEQIQ    211 - 280
KHPWYLGGKHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMI    281 - 350
YYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRA    351 - 420
LEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGGGAGE    421 - 490
QPPPPSARSTPLPGPPGSPRSSGGTPLHSPLHTPRASPTGTPGTTPPPSPGGGVGGAAWRSRLNSIRNSF    491 - 560
LGSPRFHRRKMQVPTAEEMSSLTPESSPELAKRSWFGNFISLDKEEQIFLVLKDKPLSSIKADIVHAFLS    561 - 630
IPSLSHSVLSQTSFRAEYKASGGPSVFQKPVRFQVDISSSEGPEPSPRRDGSGGGGIYSVTFTLISGPSR    631 - 700
RFKRVVETIQAQLLSTHDQPSVQALADEKNGAQTRPAGAPPRSLQPPPGRPDPELSSSPRRGPPKDKKLL    701 - 770
ATNGTPLP                                                                  771 - 778
//

Text Mined References (21)

PMID Year Title
25036402 2014 Decreased expression and prognostic role of cytoplasmic BRSK1 in human breast carcinoma: correlation with Jab1 stability and PI3K/Akt pathway.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22131368 2012 Replication of loci influencing ages at menarche and menopause in Hispanic women: the Women's Health Initiative SHARe Study.
21985311 2012 Phosphorylation of microtubule-associated protein tau by AMPK-related kinases.
20026642 2010 Persistence of the cell-cycle checkpoint kinase Wee1 in SadA- and SadB-deficient neurons disrupts neuronal polarity.
19958286 2010 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex: synergistic effects of Ca2+ and AMP.
19648910 2009 SADB phosphorylation of gamma-tubulin regulates centrosome duplication.
19448621 2009 Genome-wide association studies identify loci associated with age at menarche and age at natural menopause.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
18854318 2009 C-terminal phosphorylation of LKB1 is not required for regulation of AMP-activated protein kinase, BRSK1, BRSK2, or cell cycle arrest.
More...