Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.31
PubTator Score 96.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 7.30174743859698E-10
acute quadriplegic myopathy 1157 3.45015038975251E-8
malignant mesothelioma 3163 7.96848203871827E-6
medulloblastoma, large-cell 6234 7.01409553459614E-4

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma 1.923 0.000
medulloblastoma, large-cell 1.100 0.001
acute quadriplegic myopathy -1.691 0.000

Synonym

Accession Q8TDC0 B2R9Q4 D3DQG9 Q8IVM1 Q8IVN1
Symbols CS3
CS-3
FRP3

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
19472918 Observational study of gene-disease association. (HuGE Navigator)
11842093 Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.

AA Sequence

MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQ      1 - 70
RAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALA     71 - 140
PGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTF    141 - 210
PRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL                                 211 - 251
//

Text Mined References (9)

PMID Year Title
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11842093 2002 Calsarcin-3, a novel skeletal muscle-specific member of the calsarcin family, interacts with multiple Z-disc proteins.
10427098 1999 ZASP: a new Z-band alternatively spliced PDZ-motif protein.