Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.96
PubTator Score 96.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy -1.691 3.5e-08
malignant mesothelioma 1.300 8.0e-06
medulloblastoma, large-cell 1.100 7.0e-04
osteosarcoma 1.011 3.3e-06

Synonym

Accession Q8TDC0 B2R9Q4 D3DQG9 Q8IVM1 Q8IVN1
Symbols CS3
CS-3
FRP3

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MIPKEQKGPVMAAMGDLTEPVPTLDLGKKLSVPQDLMMEELSLRNNRGSLLFQKRQRRVQKFTFELAASQ      1 - 70
RAMLAGSARRKVTGTAESGTVANANGPEGPNYRSELHIFPASPGASLGGPEGAHPAAAPAGCVPSPSALA     71 - 140
PGYAEPLKGVPPEKFNHTAISKGYRCPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTF    141 - 210
PRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL                                 211 - 251
//

Text Mined References (9)

PMID Year Title