Property Summary

NCBI Gene PubMed Count 9
Grant Count 3
R01 Count 1
Funding $121,384.5
PubMed Score 225.68
PubTator Score 8.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.667 0.007
psoriasis -2.300 0.000
facioscapulohumeral dystrophy 2.500 0.002

Synonym

Accession Q8TDB8 B3KVB5 B3KWW7 B7Z844 B7ZAC3 Q6UY84 Q8TDB9
Symbols GLUT14
SLC2A3P3

Gene

Gene RIF (2)

PMID Text
26183839 High expression of GLUT-14 was associated with Gastric Adenocarcinoma.
22421804 SLC2A14 polymorphism has a possible role in changing the genetic susceptibility to late Alzheimer disease age of onset in a Han Chinese population.

AA Sequence

MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTL      1 - 70
TDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAES     71 - 140
VEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPV    141 - 210
LLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVT    211 - 280
VLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLV    281 - 350
ERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG    351 - 420
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE    421 - 490
GQAHGADRSGKDGVMGMNSIEPAKETTTNV                                            491 - 520
//

Text Mined References (12)

PMID Year Title
26183839 2015 Both GLUT-1 and GLUT-14 are Independent Prognostic Factors in Gastric Adenocarcinoma.
22421804 2012 Genetic association of SLC2A14 polymorphism with Alzheimer's disease in a Han Chinese population.
21630459 2011 Proteomic characterization of the human sperm nucleus.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12504846 2002 GLUT14, a duplicon of GLUT3, is specifically expressed in testis as alternative splice forms.
More...