Property Summary

NCBI Gene PubMed Count 11
PubMed Score 243.23
PubTator Score 8.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
facioscapulohumeral dystrophy 2.500 1.8e-03
mucosa-associated lymphoid tissue lympho... 1.667 7.5e-03
psoriasis -2.300 8.9e-19

Gene RIF (4)

AA Sequence

MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPETIIKEFINKTL      1 - 70
TDKANAPPSEVLLTNLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAATGGCLMGLCKIAES     71 - 140
VEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVIGILVAQIFGLELILGSEELWPV    141 - 210
LLGFTILPAILQSAALPCCPESPRFLLINRKKEENATRILQRLWGTQDVSQDIQEMKDESARMSQEKQVT    211 - 280
VLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQQPIYATISAGVVNTIFTLLSLFLV    281 - 350
ERAGRRTLHMIGLGGMAFCSTLMTVSLLLKNHYNGMSFVCIGAILVFVACFEIGPGPIPWFIVAELFSQG    351 - 420
PRPAAMAVAGCSNWTSNFLVGLLFPSAAYYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFE    421 - 490
GQAHGADRSGKDGVMGMNSIEPAKETTTNV                                            491 - 520
//

Text Mined References (14)

PMID Year Title